CAZyme Information: MGYG000002428_00267

Basic Information

• Species: Campylobacter_A concisus_W
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Campylobacteraceae; Campylobacter_A; Campylobacter_A concisus_W
• CAZyme ID: MGYG000002428_00267
• CAZy Family: GT66
• CAZyme Description: Undecaprenyl-diphosphooligosaccharide--protein glycotransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
708	MGYG000002428_1|CGC1	81935.98	8.2736

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002428	1937734	Isolate	South Africa	Africa

• Gene Location: Start: 269018; End: 271144 Strand: -

Full Sequence      

MHKVSVNCKILLIFLAAYLFGFVARMLWVLWAKEMPEFYFNGEFMLTTNDSYYYAEGARD
MLAGFHQQNDFSPFNHPISTIVFYICKVFPFKIESVMFYMSAFLAPLITLPVILISNEFK
ALKAGAVAAFMSVILPSYLSRTSPGYFDSDMLNVTFALFIIYFLIRLLNTNEQKFIVLPG
VFVSLYLWWYQSSYALILSIFFMFLLYTLVFMRDRLQNYQAVFFMFISIVSSNVFTKDPL
IANKILIFNLVVIALFFSLFCKYKNLLSARNLTIFLTLMLAIFIYFGGFDFITSKMGIYV
FKGNEILSDKFHFINEYNFISEVKSASPLYFIYFMSGNILILMAAIIGYLLLCFNFRPFL
LTLPMLGLGLLSFFGGVRFVMYVTPLVALGFGYFLHFFLNLFDLRNSIKNLSLSVFVVAT
LAINLDFAYLYRPKTVISRDEALALDELKKVTKRDDYVFSWWDYGYAIRYFADVMTLNDP
GRQGGENNYFVSLALRKDETFSARLARAAVTYNDISLEQNIRTIDKILKDYNTSDINIFL
SQLESENFSQLVAKKAVYYYLVPNMIDIAPNIFRYSYIDVTTGKRQKEDFYHVSALNGVS
EAGIDLGDGYTLPTNEQKFIIHNGEKIAVKSFYKVKGAGRDLRIDEKIVDENAKIYVIFL
EDYARILLLNENAFNSSFVQLFIFERADDRYFEPFVISSGVKIYRLKI

Enzyme Prediction     

No EC number prediction in MGYG000002428_00267.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT66	12	588	1.8e-93	0.898989898989899

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1287	Stt3	5.98e-34	1	496	9	538	Asparagine N-glycosylation enzyme, membrane subunit Stt3 [Posttranslational modification, protein turnover, chaperones].
pfam02516	STT3	1.41e-30	10	481	3	477	Oligosaccharyl transferase STT3 subunit. This family consists of the oligosaccharyl transferase STT3 subunit and related proteins. The STT3 subunit is part of the oligosaccharyl transferase (OTase) complex of proteins and is required for its activity. In eukaryotes, OTase transfers a lipid-linked core-oligosaccharide to selected asparagine residues in the ER. In the archaea STT3 occurs alone, rather than in an OTase complex, and is required for N-glycosylation of asparagines.
pfam18527	STT3_PglB_C	1.83e-05	590	668	1	79	STT3/PglB C-terminal beta-barrel domain. Asparagine-linked glycosylation is a post-translational modification of proteins containing the conserved sequence motif Asn-X-Ser/Thr. The attachment of oligosaccharides is implicated in diverse processes such as protein folding and quality control, organism development or host-pathogen interactions. The reaction is catalysed by oligosaccharyltransferase (OST), a membrane protein complex located in the endoplasmic reticulum. The central, catalytic enzyme of OST is the STT3 subunit, which has homologues in bacteria and archaea. Structural analysis of a bacterial OST, undecaprenyl-diphosphooligosaccharide protein glycotransferase EC:2.4.99.19 (PglB) protein, revealed two domains: a transmembrane domain and a periplasmic domain. This entry represents the C-terminal periplasmic beta-barrel domain.
COG0474	MgtA	0.006	201	414	704	914	Magnesium-transporting ATPase (P-type) [Inorganic ion transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPI03445.1	0.0	1	708	1	708
QPH88497.1	0.0	1	708	1	708
QPI01678.1	0.0	1	708	1	708
QPH99886.1	0.0	1	708	1	708
QPH86780.1	0.0	1	708	1	708

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3RCE_A	1.13e-119	2	707	11	711	Bacterialoligosaccharyltransferase PglB [Campylobacter lari]
5OGL_A	1.60e-115	12	707	18	711	Structureof bacterial oligosaccharyltransferase PglB in complex with an acceptor peptide and an lipid-linked oligosaccharide analog [Campylobacter lari RM2100]
6GXC_A	2.13e-115	12	707	18	711	Bacterialoligosaccharyltransferase PglB in complex with an inhibitory peptide and a reactive lipid-linked oligosaccharide analog [Campylobacter lari RM2100]
3AAG_A	7.16e-33	435	708	9	291	Crystalstructure of C. jejuni pglb C-terminal domain [Campylobacter jejuni RM1221],3AAG_B Crystal structure of C. jejuni pglb C-terminal domain [Campylobacter jejuni RM1221]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5HTX9	2.79e-121	17	708	21	713	Undecaprenyl-diphosphooligosaccharide--protein glycotransferase OS=Campylobacter jejuni (strain RM1221) OX=195099 GN=pglB PE=1 SV=1
Q0P9C8	1.09e-120	17	708	21	713	Undecaprenyl-diphosphooligosaccharide--protein glycotransferase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=pglB PE=1 SV=1
B9KDD4	8.86e-119	2	707	11	711	Undecaprenyl-diphosphooligosaccharide--protein glycotransferase OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) OX=306263 GN=pglB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999817	0.000181	0.000007	0.000001	0.000000	0.000012

TMHMM  Annotations     

start	end
10	32
93	115
151	168
175	190
194	211
218	235
240	259
272	294
330	352
359	376
380	402
411	430