CAZyme Information: MGYG000002428_01411

Basic Information

• Species: Campylobacter_A concisus_W
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Campylobacteraceae; Campylobacter_A; Campylobacter_A concisus_W
• CAZyme ID: MGYG000002428_01411
• CAZy Family: GH24
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
146		16310.82	8.8869

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002428	1937734	Isolate	South Africa	Africa

• Gene Location: Start: 32609; End: 33049 Strand: -

Full Sequence      

MSLKENIKENEGFKSYIYQDTRGYPTVGYGFKVSSLSKDELFLNGGKAEPMSKAAAEQIL
EIKLIKLASSVCEAFPWLEDKPKNVQDVVIEMCYQMGVPGVKKFVTTLNFIKSGEYEAAY
KNGLNSLWAKQTPNRAKKVLSGLLDN

Enzyme Prediction     

No EC number prediction in MGYG000002428_01411.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH24	4	143	4.1e-18	0.9051094890510949

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00735	T4-like_lys	2.32e-32	2	139	1	135	bacteriophage T4-like lysozymes. Bacteriophage T4-like lysozymes hydrolyze the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetylglucosamine (GlcNAc) in peptidoglycan heteropolymers of prokaryotic cell walls. Members include a variety of bacteriophages (T4, RB49, RB69, Aeh1), as well as Dictyostelium.
PHA02596	5	4.89e-23	1	139	173	324	baseplate hub subunit and tail lysozyme; Provisional
cd00737	lyz_endolysin_autolysin	1.34e-07	7	143	5	124	endolysin and autolysin. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
COG3772	RrrD	2.62e-04	7	143	15	136	Phage-related lysozyme (muramidase), GH24 family [Cell wall/membrane/envelope biogenesis].
cd16902	pesticin_lyz	6.08e-04	4	137	4	173	lysozyme-like C-terminal domain of pesticin. Pesticin (Pst) is an anti-bacterial toxin produced by Yersinia pestis that acts through uptake by the target related bacteria and the hydrolysis of peptidoglycan in the periplasm. Pst contains an N-terminal translocation domain, an intermediate receptor binding domain, and a phage-lysozyme like C-terminal activity domain. Bacteriocins such as pesticin are produced by gram-negative bacteria to attack related bacterial stains. Pst is transported to the periplasm via FyuA, an outer-membrane receptor of Y. pestis and E. coli, where it hydrolyzes peptidoglycan via the cleavage of N-acetylmuramic acid and C4 of N-acetylglucosamine. Disruption of the peptidoglycan layer renders the bacteria vulnerable to lysis via osmotic pressure. The pesticin C-terminal domain resembles the lysozyme-like family, which includes soluble lytic transglycosylases (SLT), goose egg-white lysozymes (GEWL), hen egg-white lysozymes (HEWL), chitinases, bacteriophage lambda lysozymes, endolysins, autolysins, and chitosanases. All the members are involved in the hydrolysis of beta-1,4- linked polysaccharides.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALF47771.1	7.08e-95	1	144	1	144
AKT92067.1	2.15e-69	1	144	1	144
QCT99357.1	8.20e-69	1	145	1	145
AVK80669.1	1.81e-56	1	139	1	139
ANE33770.1	7.36e-56	1	139	1	139

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6XC0_A	3.28e-16	1	139	1	154	ChainA, Lysozyme [Tequatrovirus T4],6XC0_B Chain B, Lysozyme [Tequatrovirus T4],6XC1_A Chain A, Lysozyme [Tequatrovirus T4]
7CN7_A	3.55e-16	1	139	13	166	ChainA, Baseplate central spike complex protein gp5 [Tequatrovirus T4]
1PDL_A	3.59e-15	1	139	174	327	ChainA, Tail-associated lysozyme [Tequatrovirus T4],1PDL_B Chain B, Tail-associated lysozyme [Tequatrovirus T4],1PDL_C Chain C, Tail-associated lysozyme [Tequatrovirus T4],5IV5_YA Chain YA, Peptidoglycan hydrolase gp5 [Tequatrovirus T4],5IV5_YB Chain YB, Peptidoglycan hydrolase gp5 [Tequatrovirus T4],5IV5_YC Chain YC, Peptidoglycan hydrolase gp5 [Tequatrovirus T4]
1WTH_A	3.60e-15	1	139	174	327	ChainA, Tail-associated lysozyme [Tequatrovirus T4]
2Z6B_A	3.60e-15	1	139	174	327	ChainA, Tail-associated lysozyme [Tequatrovirus T4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q556F2	2.02e-16	2	141	4	159	Probable T4-type lysozyme 1 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0274831 PE=3 SV=1
P16009	1.97e-14	1	139	174	327	Pre-baseplate central spike protein Gp5 OS=Enterobacteria phage T4 OX=10665 GN=5 PE=1 SV=2
Q86AA1	1.06e-10	2	141	4	159	Probable T4-type lysozyme 2 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0274291 PE=2 SV=1
P00720	3.66e-10	1	141	1	151	Endolysin OS=Enterobacteria phage T4 OX=10665 GN=E PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002428_01411.