CAZyme Information: MGYG000002429_01335

Basic Information

• Species: Campylobacter_A concisus_I
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Campylobacteraceae; Campylobacter_A; Campylobacter_A concisus_I
• CAZyme ID: MGYG000002429_01335
• CAZy Family: GT25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
253	MGYG000002429_5|CGC1	28763.98	8.0963

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002429	1854434	Isolate	South Africa	Africa

• Gene Location: Start: 33030; End: 33791 Strand: +

Full Sequence      

MDEIYLISLAKDTKRRELLQQKFSSYDSFKLIDAVDGRELNAREYYKIISPSFNAYGKVL
SPAEVGCSLSHVKAYEAFLASEAKFALIFEDDVIGDDQAIKEAFLAASKMPENSVLICGM
QDGLEGRFSAFGKKVDTSLSKPLWQVSKHSFSSIYRAGAYVLTKKSTKNLLEIHKRALCT
TDVWDYLLGVNDMQMYFCDLFSHPTDLSGSNIEGERLERGYRANLKAYINTIKFILFSRL
EKLQGYERIFKRG

Enzyme Prediction     

No EC number prediction in MGYG000002429_01335.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT25	1	180	1.3e-25	0.9668508287292817

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06532	Glyco_transf_25	2.30e-27	3	94	1	94	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.
pfam01755	Glyco_transf_25	3.97e-17	1	175	1	190	Glycosyltransferase family 25 (LPS biosynthesis protein). Members of this family belong to Glycosyltransferase family 25 This is a family of glycosyltransferases involved in lipopolysaccharide (LPS) biosynthesis. These enzymes catalyze the transfer of various sugars onto the growing LPS chain during its biosynthesis.
COG3306	COG3306	7.10e-17	3	177	4	177	Glycosyltransferase involved in LPS biosynthesis, GR25 family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALF48122.1	4.29e-176	1	253	1	253
QPH98113.1	4.29e-176	1	253	1	253
QPI03443.1	5.00e-175	1	253	1	253
QPH88495.1	5.00e-175	1	253	1	253
QPH91431.1	7.11e-175	1	253	1	253

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5U309	2.30e-08	2	97	297	398	Probable inactive glycosyltransferase 25 family member 3 OS=Rattus norvegicus OX=10116 GN=Cercam PE=2 SV=2
Q5T4B2	1.02e-07	2	93	320	417	Inactive glycosyltransferase 25 family member 3 OS=Homo sapiens OX=9606 GN=CERCAM PE=1 SV=1
A7MB73	1.37e-07	2	93	320	417	Probable inactive glycosyltransferase 25 family member 3 OS=Bos taurus OX=9913 GN=CERCAM PE=2 SV=1
A3KGW5	1.83e-07	2	93	317	414	Inactive glycosyltransferase 25 family member 3 OS=Mus musculus OX=10090 GN=Cercam PE=3 SV=1
A5PMF6	2.58e-06	2	93	323	420	Procollagen galactosyltransferase 1 OS=Danio rerio OX=7955 GN=colgalt1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002429_01335.