CAZyme Information: MGYG000002431_01196

Basic Information

• Species: Campylobacter_A concisus_I
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Campylobacteraceae; Campylobacter_A; Campylobacter_A concisus_I
• CAZyme ID: MGYG000002431_01196
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
536		61821.84	9.0648

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002431	1906669	Isolate	Denmark	Europe

• Gene Location: Start: 9630; End: 11240 Strand: +

Full Sequence      

MKTLFLIPFYNHPEKIKALCEALASYDLPILIVDDGSNETSKKALQNLSEFGVEIFTRAQ
NGGKGAALKDGFRHAVQNGYTHAFQIDADFQHDISEVTEFLELSRKYPYDMIMADPIYGE
DAPKSRFYGRKITNFWVKVNTLSTNIKDAMCGFRIYPLKELESATFQSSSNRMEFDMEIL
VNAVRAGIRLKWIPLKVRYEKGGISHFKMLEDNVLISLMHAKYFFSLVPFLLGKAFKGQK
YVWWQKGERSNEFFLRVSLFLTKNLPIFLIKPIVMIVVCFYYIFSKIERKNIREFLQNVE
KFSGKKPTTGVFRNFYEFGIAICDKFRIWQNGVLENELDIDELMWIKEEFEASKRGRILL
TSHLGNVEICKTLSLRSPSFRMIILVYSKGNENFYKILEQISKGQIKLISVENLDAAAML
DLKEAVEGGVNIGIMGDRTPVNGDKFVEVSFLGKMAKFNYGPYLLAGILGVKMSTLWCVK
NGDKFSIELSDIADEIKLGRDRKASVMPYVQSYVRQLEDHACKNPSQWFNFFDFWR

Enzyme Prediction     

No EC number prediction in MGYG000002431_01196.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	6	158	7e-19	0.8352941176470589

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4261	COG4261	1.65e-49	243	535	4	299	Predicted acyltransferase, LPLAT superfamily [General function prediction only].
cd04179	DPM_DPG-synthase_like	1.38e-36	6	181	2	183	DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily.
cd06442	DPM1_like	2.75e-19	6	194	2	196	DPM1_like represents putative enzymes similar to eukaryotic DPM1. Proteins similar to eukaryotic DPM1, including enzymes from bacteria and archaea; DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. This protein family belongs to Glycosyltransferase 2 superfamily.
cd07984	LPLAT_LABLAT-like	1.62e-18	348	536	13	192	Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: LABLAT-like. Lysophospholipid acyltransferase (LPLAT) superfamily member: acyltransferases of de novo and remodeling pathways of glycerophospholipid biosynthesis which catalyze the incorporation of an acyl group from either acylCoAs or acyl-acyl carrier proteins (acylACPs) into acceptors such as glycerol 3-phosphate, dihydroxyacetone phosphate or lyso-phosphatidic acid. Included in this subgroup are such LPLATs as lipid A biosynthesis lauroyl/myristoyl (LABLAT, HtrB) acyltransferases and similar proteins.
pfam00535	Glycos_transf_2	2.56e-14	6	156	3	159	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPH98941.1	0.0	1	536	1	536
QPI00737.1	0.0	1	536	1	536
ALF47118.1	0.0	1	536	1	536
AVX44679.1	0.0	1	536	9	544
QPI07289.1	0.0	1	536	1	536

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A2DSR8	1.10e-09	3	220	75	311	Dolichyl-phosphate beta-glucosyltransferase ALG5E OS=Trichomonas vaginalis OX=5722 GN=ALG5E PE=1 SV=1
Q58619	3.17e-08	6	205	22	222	Uncharacterized protein MJ1222 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1222 PE=4 SV=1
Q9LM93	6.29e-07	2	195	14	215	Dolichol-phosphate mannosyltransferase subunit 1 OS=Arabidopsis thaliana OX=3702 GN=DPMS1 PE=1 SV=1
D4GUA0	6.53e-07	6	212	22	235	Glycosyltransferase AglD OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=aglD PE=1 SV=1
A2DZE8	8.21e-07	6	220	78	311	Dolichyl-phosphate beta-glucosyltransferase ALG5A OS=Trichomonas vaginalis OX=5722 GN=ALG5A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
265	284