CAZyme Information: MGYG000002434_00334

Basic Information

• Species: Campylobacter_A concisus_G
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Campylobacteraceae; Campylobacter_A; Campylobacter_A concisus_G
• CAZyme ID: MGYG000002434_00334
• CAZy Family: GH24
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
144		16234.78	6.7329

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002434	1924634	Isolate	Denmark	Europe

• Gene Location: Start: 16977; End: 17411 Strand: +

Full Sequence      

MTLIEKIKENEGLEDHRYEDNLGRPTVGYGFLLAALTADELALNGGKYEPMSKETADKIL
ELKLEKLTAAVFATFDWLKEKPQNVQEVVIEMAYQLGVSKVKKFVTTMHHIRMGEYEAAY
QSGMNSLWAKQTPNRAKKVLGGLL

Enzyme Prediction     

No EC number prediction in MGYG000002434_00334.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH24	3	142	2.4e-17	0.9051094890510949

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00735	T4-like_lys	9.50e-25	2	139	1	135	bacteriophage T4-like lysozymes. Bacteriophage T4-like lysozymes hydrolyze the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetylglucosamine (GlcNAc) in peptidoglycan heteropolymers of prokaryotic cell walls. Members include a variety of bacteriophages (T4, RB49, RB69, Aeh1), as well as Dictyostelium.
PHA02596	5	4.48e-17	1	139	173	324	baseplate hub subunit and tail lysozyme; Provisional
COG3772	RrrD	3.27e-06	3	143	11	136	Phage-related lysozyme (muramidase), GH24 family [Cell wall/membrane/envelope biogenesis].
cd00737	lyz_endolysin_autolysin	8.40e-06	4	71	2	61	endolysin and autolysin. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCT99357.1	2.27e-70	1	143	1	143
AKT92067.1	4.46e-66	1	144	1	144
ALF47771.1	2.68e-62	1	144	1	144
ANE33770.1	5.80e-50	1	139	1	139
ALV24926.1	1.13e-49	1	143	1	143

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6XC0_A	5.60e-11	1	139	1	154	ChainA, Lysozyme [Tequatrovirus T4],6XC0_B Chain B, Lysozyme [Tequatrovirus T4],6XC1_A Chain A, Lysozyme [Tequatrovirus T4]
7CN7_A	5.96e-11	1	139	13	166	ChainA, Baseplate central spike complex protein gp5 [Tequatrovirus T4]
209L_A	1.81e-10	1	140	1	153	ChainA, T4 LYSOZYME [Tequatrovirus T4]
1WTH_A	2.28e-10	1	139	174	327	ChainA, Tail-associated lysozyme [Tequatrovirus T4]
1K28_A	2.28e-10	1	139	174	327	ChainA, Tail-associated Lysozyme [Escherichia phage T4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P16009	1.25e-09	1	139	174	327	Pre-baseplate central spike protein Gp5 OS=Enterobacteria phage T4 OX=10665 GN=5 PE=1 SV=2
P00720	2.64e-07	1	140	1	150	Endolysin OS=Enterobacteria phage T4 OX=10665 GN=E PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002434_00334.