CAZyme Information: MGYG000002435_00167

Basic Information

• Species: Campylobacter_A concisus
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Campylobacteraceae; Campylobacter_A; Campylobacter_A concisus
• CAZyme ID: MGYG000002435_00167
• CAZy Family: GT9
• CAZyme Description: ADP-heptose--LPS heptosyltransferase 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
314	MGYG000002435_2|CGC1	35650.96	9.5862

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002435	1884438	Isolate	Denmark	Europe

• Gene Location: Start: 166024; End: 166968 Strand: +

Full Sequence      

MRVFIELPTWLGDAVMASAAIENLSKDAKNIVFFGSYVACELYKSHPKCEKVVIDDSKKQ
NSRYLSLIKTASKLGKFDIAISFRSSFASKFLLFFLKAKQKFCFKKSSESLHQVQKYLNF
IKKSLNLKEISNELKIYYEAKKSEQKLLVLNPGASYGSAKRWYPHYFAEVALHFKDEFDV
KITGSKAELEICNEIEQILLQNGVKCENLAGKTSIKELCEVIGSIKNGIFLTNDSGPMHI
AAAYKVPLVALFGPTKFKETSPWQDESAKMVHLNLDCMPCMKRVCPIKTHACMKELTPKM
VIAEIELLRKKLNF

Enzyme Prediction     

No EC number prediction in MGYG000002435_00167.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	67	291	6.5e-52	0.9688888888888889

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	1.07e-62	2	306	1	276	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	4.77e-58	1	311	2	332	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
TIGR02195	heptsyl_trn_II	3.07e-41	143	308	172	332	lipopolysaccharide heptosyltransferase II. This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
pfam01075	Glyco_transf_9	7.38e-33	77	288	13	244	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10916	PRK10916	1.47e-19	152	273	187	307	ADP-heptose--LPS heptosyltransferase RfaF.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALF47139.1	5.85e-225	1	314	1	314
QPH98962.1	7.64e-221	1	314	1	314
QPI00758.1	7.64e-221	1	314	1	314
QPH83978.1	1.54e-220	1	314	1	314
QPH85854.1	4.94e-217	1	314	1	314

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1PSW_A	5.13e-17	143	308	178	342	Structureof E. coli ADP-heptose lps heptosyltransferase II [Escherichia coli]
3TOV_A	4.62e-08	2	264	10	299	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37692	1.73e-17	143	308	178	342	ADP-heptose--LPS heptosyltransferase 2 OS=Escherichia coli (strain K12) OX=83333 GN=rfaF PE=1 SV=1
P45042	2.32e-17	1	310	1	346	ADP-heptose--LPS heptosyltransferase 2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=rfaF PE=3 SV=1
P37421	8.16e-17	143	305	178	339	ADP-heptose--LPS heptosyltransferase 2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002435_00167.