CAZyme Information: MGYG000002436_03455

Basic Information

• Species: Pigmentiphaga sp002188635
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Pigmentiphaga; Pigmentiphaga sp002188635
• CAZyme ID: MGYG000002436_03455
• CAZy Family: GT2
• CAZyme Description: Cellulose synthase catalytic subunit [UDP-forming]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
393	MGYG000002436_36|CGC3	42841.79	9.168

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002436	5862145	Isolate	Canada	North America

• Gene Location: Start: 196411; End: 197592 Strand: +

Full Sequence      

MGLIYLLLCLAAVPATVSCLYLGLMTLLSWRAPIPQPASRSLRFDILVPAHNEAAVIERT
VASLLQIDWPADRMRVVVIADNCSDDTARLAAAAGATVIERRDDTLRGKGYALAHGIAHS
AAGQWADAIAVVDADTVVSPNFLSAFAARIERGAQALQANYGVLNPDDSWRTRIITIAYG
AFHAVRGRARERLRVSCGLRGNGMGFTHELLRDHPFRSVSLTEDLEQGIVLGLEGIRVWY
VDEAHADAELVATGSASVSQRQRWEGGRFAVIRIYTGRLLRAGLTRPDRICLDLALDLLT
LPIGYVALEIGALLALALLAALVTPAAWAWVGWAILMGIILGAHILRGWQLGPLGPRALL
DLARAPFFVLWKLHALLRRRGEQGWVKTRRDGQ

Enzyme Prediction     

No EC number prediction in MGYG000002436_03455.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	44	266	3.7e-26	0.9782608695652174

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06438	EpsO_like	3.97e-75	46	226	1	182	EpsO protein participates in the methanolan synthesis. The Methylobacillus sp EpsO protein is predicted to participate in the methanolan synthesis. Methanolan is an exopolysaccharide (EPS), composed of glucose, mannose and galactose. A 21 genes cluster was predicted to participate in the methanolan synthesis. Gene disruption analysis revealed that EpsO is one of the glycosyltransferase enzymes involved in the synthesis of repeating sugar units onto the lipid carrier.
cd06423	CESA_like	2.75e-34	46	224	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
COG1215	BcsA	1.48e-22	1	264	12	280	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
pfam13641	Glyco_tranf_2_3	1.19e-18	43	267	3	230	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
cd06437	CESA_CaSu_A2	2.53e-17	46	267	5	231	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZG09786.1	5.52e-269	2	393	8	399
AZY49986.1	2.56e-176	4	391	5	394
AZY53351.1	1.47e-175	4	391	5	394
CAJ50256.1	1.47e-175	4	391	5	394
AZR93367.1	5.76e-175	4	393	5	396

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LBY_A	4.04e-07	31	291	260	523	ChainA, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9WX61	1.05e-09	31	291	136	399	Cellulose synthase 1 catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsAI PE=3 SV=1
P96587	2.17e-08	43	294	50	303	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1
Q9SB75	7.02e-08	46	280	231	475	Probable xyloglucan glycosyltransferase 5 OS=Arabidopsis thaliana OX=3702 GN=CSLC5 PE=1 SV=1
P19449	2.24e-07	31	291	136	399	Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsA PE=1 SV=1
O82859	2.96e-07	31	291	136	401	Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter sucrofermentans (strain ATCC 700178 / DSM 15973 / CECT 7291 / JCM 9730 / LMG 18788 / BPR 2001) OX=1307942 GN=bcsA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.960059	0.024405	0.014766	0.000105	0.000065	0.000636

TMHMM  Annotations     

start	end
2	24
298	320
327	349