CAZyme Information: MGYG000002436_03532

Basic Information

• Species: Pigmentiphaga sp002188635
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Pigmentiphaga; Pigmentiphaga sp002188635
• CAZyme ID: MGYG000002436_03532
• CAZy Family: GT2
• CAZyme Description: Cellulose synthase catalytic subunit [UDP-forming]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
736	MGYG000002436_37|CGC1	81419.71	8.8914

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002436	5862145	Isolate	Canada	North America

• Gene Location: Start: 67487; End: 69697 Strand: +

Full Sequence      

MSALPPAVPTADHAPADAKADRLAALPLWNNRIVRFALAAVACCSLAVVITAPLEALPQL
VLALVALVAALALRNVAGRMPTVLMVLLSATMSLRYMYWRLTSTLDFQSWLDIAFGYGLM
LAELYALSVLLLGYLQTIWPLRRLPAAMPADPATWPSVDILIPTYNEPLDVVKQSVLTAV
SLDWPTDRLRIFVLDDGRRKEFQDFCTALGVGYIARNNNEAAKAGNLNAALELTSGEYVA
VFDCDHIPTRSFLQISIGWFLKDPKLAMLQTPHYFFSADPFEKNLHTFRAVPNEGELFYG
LVQDGNDLWNAAFFCGSCAVLRRSHLEEVGGIATETVTEDAHTALKLNRAGYNTAYLAVP
QAAGLATENLSRHIGQRVRWARGMAQIFRVDNPLFGKGLSLSQRMCYLNAMLHFFYGLPR
LVFLTAPLAFLFFGAHVFQASALMITLYAFPHLIHANLTSSRMQGRFRHSFWNEVYESVL
AWYIMRPAMLALINPKLGGFNVTAKGGAMGNAWFDWDMAKPYLVLLALNIAGLLAGLVSL
IFVDYDAGGLFTLAINLLWTLYNIVITSASIAVAREERQFRAQPRVAAQIPAMLRLENGK
TIACSTTDYSATGLGIQLPPELGRLETGQAVHVALFRGTEQRTFPAHIMFAGDRHVGLRF
TSLTMRQQVEMAEMTFARADTWADNWGQGTPDAPLASLREVTRIGLLGMKQLAIHGSQVV
RARLQARPTHTRMKNR

Enzyme Prediction     

EC	2.4.1.12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	159	330	4.6e-35	0.9941176470588236

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR03030	CelA	0.0	26	714	2	707	cellulose synthase catalytic subunit (UDP-forming). Cellulose synthase catalyzes the beta-1,4 polymerization of glucose residues in the formation of cellulose. In bacteria, the substrate is UDP-glucose. The synthase consists of two subunits (or domains in the frequent cases where it is encoded as a single polypeptide), the catalytic domain modelled here and the regulatory domain (pfam03170). The regulatory domain binds the allosteric activator cyclic di-GMP. The protein is membrane-associated and probably assembles into multimers such that the individual cellulose strands can self-assemble into multi-strand fibrils.
PRK11498	bcsA	0.0	11	725	118	826	cellulose synthase catalytic subunit; Provisional
cd06421	CESA_CelA_like	4.92e-116	156	388	1	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
COG1215	BcsA	7.59e-58	119	570	16	430	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06437	CESA_CaSu_A2	1.03e-31	156	383	1	231	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZG10374.1	0.0	1	736	1	736
QEI07405.1	0.0	15	732	16	733
ARP79412.1	0.0	18	715	16	712
AVP56381.1	0.0	19	726	27	733
SOE50263.1	0.0	26	731	27	731

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LBY_A	3.81e-247	50	713	167	827	ChainA, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
5EJ1_A	6.21e-112	28	619	9	610	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	3.82e-111	28	619	21	622	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	3.91e-111	28	619	22	623	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
6YV7_B	5.17e-14	151	388	37	268	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P58931	5.83e-306	49	733	52	736	Cellulose synthase catalytic subunit [UDP-forming] OS=Pseudomonas fluorescens (strain SBW25) OX=216595 GN=bcsA PE=3 SV=2
Q93IN2	1.75e-247	50	713	167	827	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bcsA PE=3 SV=1
Q8X5L7	6.60e-247	50	713	167	827	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli O157:H7 OX=83334 GN=bcsA PE=3 SV=2
Q8Z291	7.04e-247	50	713	167	827	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhi OX=90370 GN=bcsA PE=3 SV=1
P37653	1.32e-246	50	713	167	827	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli (strain K12) OX=83333 GN=bcsA PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999906	0.000098	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
33	52
56	73
80	98
113	135
411	433
437	459
521	543
553	575