CAZyme Information: MGYG000002437_01875

Basic Information

• Species: Blautia hominis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia; Blautia hominis
• CAZyme ID: MGYG000002437_01875
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
801	MGYG000002437_2|CGC8	87596.54	4.8693

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002437	5878941	Isolate	South Korea	Asia

• Gene Location: Start: 771962; End: 774367 Strand: +

Full Sequence      

MEKYLNPELTPEERAEDLLCKMSLDEKMGQVNCLFPYGDNKDTVAHDMRHGIGQVSTLEV
REITSLEKAAAWQRSLQERIMECSEHHIPAIFHMEGLCGAFIQDAASFPSNIGRGSSWNP
ALEQKIGEIVSRQELACGITQVLAPVLDISRDSRMGRQCESYGEDPALAAAMGTAYTKGV
QEGSAAGRKAESAAKHFLGFHNSQGGIHGANCDVPDRLLDEVYGKPFQCAIKEAGLRGVM
PCYSSINGEPLSVSKRMLTGLLREEMGFDGICVADYSAVSNVHTTQKIGESLADVGLLSM
DAGMDVEMQNCVCFNEELKERFRSGEADMMILDRAVRRVLEAKFRMGLFEHPFALTENEL
KETFYDEKDKEVSLQSALESLILLKNTGVLPIAKDVRKIAVIGCHADNARAFFGGYTHLS
MVEAVHAVANSIAGLESGSMNGKKAAMVAGTQVQSDESEEFDAILKQQKPECKSLLKKLK
EVLPEVSICYAYGYPVAGNDITHFPEALEAVQEADLVLMTLGGKNGSCSVATMGEGVDGT
NINLPFCQEEFIREAAKYEKPLVGIHFDGRPISSDAADQYLDAILEAWNPSEMGADAIVK
VLTGAYNPCGKLPVSAARNAGQIPIYYNHPNGSAYHQGGSIGFKDYVDMPHTPRYFFGHG
LSYTEFEYTSLVLSADEIGPDGSVRVTVSVKNTGACGGTEIVQLYIRDVYASMTRPVKEL
AGFAKVYLDAGEEKKIEFVLNASQTAFLDRNMKWKVEKGEMEVQVGKSSEEICLKDTVMI
TKDAWIQGRERAFYTIGKVNG

Enzyme Prediction     

No EC number prediction in MGYG000002437_01875.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	83	308	1.2e-54	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	2.00e-131	6	772	26	757	beta-glucosidase BglX.
COG1472	BglX	1.49e-66	22	433	1	388	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	1.07e-56	23	342	1	316	Glycosyl hydrolase family 3 N terminal domain.
PLN03080	PLN03080	2.43e-50	4	741	42	743	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	3.13e-34	381	663	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRT50982.1	0.0	3	794	7	811
VCV22852.1	0.0	3	794	7	811
CBL11432.1	0.0	3	794	7	811
AJG98232.1	0.0	1	794	5	800
AIQ70324.1	0.0	4	794	8	800

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5Z87_A	5.76e-97	4	772	36	777	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5XXL_A	4.98e-93	18	772	17	744	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	2.60e-92	18	772	17	744	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5YOT_A	4.04e-92	3	772	6	748	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	2.93e-91	3	772	6	748	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56078	8.98e-102	6	769	26	754	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
T2KMH0	2.46e-101	73	781	43	721	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
P33363	1.98e-97	6	769	26	754	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH9	2.50e-92	4	769	29	744	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
P14002	3.86e-74	105	789	67	677	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002437_01875.