CAZyme Information: MGYG000002438_01013

Basic Information

• Species: Parabacteroides distasonis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides distasonis
• CAZyme ID: MGYG000002438_01013
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1047	MGYG000002438_1|CGC15	119025.84	5.2653

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002438	5030699	Isolate	South Korea	Asia

• Gene Location: Start: 1087525; End: 1090668 Strand: -

Full Sequence      

MFLTGCVSSLSAQQSFWKEDFSAGKLPDGWMIVDSTKSAKCEWIVTDQPYPGSFQFEQQA
PPIASTSRGYHMQFRPGVVTGEEITKWNQREEYPNGYFQTSAIDCAGKNDVVLKFQHLFR
WNNWFTGKRAGLWVGVSNDGVNWKEYNVMDKIPAATQLHAPVNEEINISEVAANQKTVYL
RFFWRDIFSWYWMVDDIELTEPFAHDLALEKVTSHQETGNTFTKEDVLKVKLKNVGSQPV
DEDFTVTASLNNGQKLTATVTASGHPIAKQEEYEVAFPATDLTQMGSYKIEFAIQYPKDE
RSSNNILKANLFAARMNLGKLTKFNKISNTEYEFVSGYAKVKLMFYRDDIFRIWLAPDGE
YTNPAANSIVVDYGVKNPRVSMADNGSYYKFTTSQCVVRVYKNPIRFAMYDKNNRAVIYE
EAEPLAFGLKTTQTMRRSGDEDFYGCGMQQGNFSYAGKEADIEVTGWDEDQSSNPAPFYM
STKGYGVFRNTFAPGHYAFNGTEMLDKNYDDGFKLMGFTSQLTHNENRFDAFYFYGPSLK
DLLNDYTDITGKPFMPAMWMLTMGDADCYNKGEQRTGWPQSTPDVISQVADKYVEYDMPR
GWILPNDGYGCGYVKLDSVVTELGKRGFHTGLWTENGVDKIAYEVGKCGTRLCKLDVAWV
GEGYEFALNGCKSAFEGIESNTNERGFVWAVCGWAGTQRYSTVWSGDQVSNWDYIRYHIP
TITGAGLSAMNAATSDVDGIFGGSPKTYTRDLQWKVFTPIFMTMSGWADADRQPWVYGHP
YTDINRKFLKLKMRLNPYAYTYCHEAHMTGVPMARAMVLEFPDDVVTRDTTTQYQFMSGE
WMMVAPVYTRKNVRDSIYFPAGEWYDYWTGKKYEGGKWLDKYEAKLDICPVFIRQGAIIP
MYPDMNYVGEKPADVLTLDLYPYGNTSFNLYEDDGLTRDYKKGEFARTLISVSSPKGEKG
TITVDIAKAKGDYKGRYQERTYLLDVRSESSPSNVTVAEKPLSAISPEAFNAGQEGWYFD
ASDRMGRVKVRTNRLSTNQDQKIVIGF

Enzyme Prediction     

No EC number prediction in MGYG000002438_01013.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	668	899	1.2e-70	0.5362997658079626

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06596	GH31_CPE1046	0.0	549	870	1	334	Clostridium CPE1046-like. CPE1046 is an uncharacterized Clostridium perfringens protein with a glycosyl hydrolase family 31 (GH31) domain. The domain architecture of CPE1046 and its orthologs includes a C-terminal fibronectin type 3 (FN3) domain and a coagulation factor 5/8 type C domain in addition to the GH31 domain. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
COG1501	YicI	2.14e-82	396	986	111	772	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
pfam01055	Glyco_hydro_31	7.96e-74	532	899	1	442	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
cd06603	GH31_GANC_GANAB_alpha	1.02e-45	672	901	198	428	neutral alpha-glucosidase C, neutral alpha-glucosidase AB. This subgroup includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB). Initially distinguished on the basis of differences in electrophoretic mobility in starch gel, GANC and GANAB have been shown to have other differences, including those of substrate specificity. GANC and GANAB are key enzymes in glycogen metabolism that hydrolyze terminal, non-reducing 1,4-linked alpha-D-glucose residues from glycogen in the endoplasmic reticulum. The GANC/GANAB family includes the alpha-glucosidase II (ModA) from Dictyostelium discoideum as well as the alpha-glucosidase II (GLS2, or ROT2 - Reversal of TOR2 lethality protein 2) from Saccharomyces cerevisiae.
PLN02763	PLN02763	4.18e-33	672	974	378	669	hydrolase, hydrolyzing O-glycosyl compounds

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT20559.1	0.0	1	1047	1	1047
QRO18378.1	0.0	1	1047	9	1055
ABR45242.1	0.0	1	1047	9	1055
QUT52716.1	0.0	1	1047	1	1047
QCY54815.1	0.0	1	1047	9	1055

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6M76_A	6.02e-135	297	1020	16	815	GH31alpha-N-acetylgalactosaminidase from Enterococcus faecalis [Enterococcus faecalis ATCC 10100],6M77_A GH31 alpha-N-acetylgalactosaminidase from Enterococcus faecalis in complex with N-acetylgalactosamine [Enterococcus faecalis ATCC 10100]
7F7R_A	3.19e-134	297	1020	16	815	ChainA, GH31 alpha-N-acetylgalactosaminidase [Enterococcus faecalis ATCC 10100]
7F7Q_A	8.69e-134	297	1020	16	815	ChainA, GH31 alpha-N-acetylgalactosaminidase [Enterococcus faecalis ATCC 10100]
6JR8_A	2.63e-69	318	1030	30	825	Flavobacteriumjohnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101],6JR8_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101],6JR8_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101],6JR8_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101]
6JR6_A	3.57e-69	318	1030	30	825	Flavobacteriumjohnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR7_A Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9F234	1.18e-62	292	974	7	746	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1
Q9P999	1.34e-48	337	972	4	690	Alpha-xylosidase OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=xylS PE=1 SV=1
Q9FN05	5.24e-35	530	945	333	828	Probable glucan 1,3-alpha-glucosidase OS=Arabidopsis thaliana OX=3702 GN=PSL5 PE=1 SV=1
B9F676	8.37e-34	684	945	563	826	Probable glucan 1,3-alpha-glucosidase OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0216600 PE=3 SV=1
A7LXT0	1.31e-31	666	982	587	921	Alpha-xylosidase BoGH31A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02646 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.194427	0.024525	0.780977	0.000028	0.000032	0.000031

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002438_01013.