CAZyme Information: MGYG000002439_00585

Basic Information

• Species: CHH4-2 sp002899675
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CHH4-2; CHH4-2 sp002899675
• CAZyme ID: MGYG000002439_00585
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
286	MGYG000002439_2|CGC2	32880.44	7.4236

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002439	6089737	Isolate	Taiwan	Asia

• Gene Location: Start: 227825; End: 228685 Strand: +

Full Sequence      

MKYFGEGLSEKQKELSGIIRKKERSGEAGISFVRNGVKSKRKKRLAVWCILLCLLIFLTA
MGIGVGTKKIKLNRFFSKMYQVHGVDVSHYQGTIDWPVLSESGIRFAFIKATEGSGHVDE
NFAENWENVKETGLYAGAYHFFSFDSPAETQADLFIATVPKEEGRLAPVVDIEFYGDKAS
NRPDPDSVREQLSILLGRMEAHYGVKPVIYTTMRMYDSYIKGHYEEYPLWIRNTYYTPDF
GMKGKWTFWQYSDTEKRSGYSGQEAFIDMNVFKGSEEDLKEFLQKE

Enzyme Prediction     

No EC number prediction in MGYG000002439_00585.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	85	259	2.3e-50	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06413	GH25_muramidase_1	2.95e-95	80	274	1	191	Uncharacterized bacterial muramidase containing a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
COG3757	Acm	4.16e-61	80	283	61	264	Lyzozyme M1 (1,4-beta-N-acetylmuramidase), GH25 family [Cell wall/membrane/envelope biogenesis].
cd00599	GH25_muramidase	1.28e-57	83	272	1	186	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
cd06524	GH25_YegX-like	6.66e-57	83	274	1	194	YegX is an uncharacterized bacterial protein with a glycosyl hydrolase family 25 (GH25) catalytic domain that is similar in sequence to the CH-type (Chalaropsis-type) lysozymes of the GH25 family of endolysins.
pfam01183	Glyco_hydro_25	1.43e-46	85	259	1	179	Glycosyl hydrolases family 25.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL16560.1	2.41e-74	41	282	6	250
BCI60136.1	4.01e-73	58	282	20	244
AZJ21462.1	1.38e-72	73	282	32	241
QCT71758.1	1.42e-72	70	275	30	236
QWH67350.1	1.95e-72	73	282	32	241

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WAG_A	1.47e-72	80	286	14	220	TheStructure of a family 25 Glycosyl hydrolase from Bacillus anthracis. [Bacillus anthracis str. Ames]
1JFX_A	2.08e-24	82	275	5	205	Crystalstructure of the bacterial lysozyme from Streptomyces coelicolor at 1.65 A resolution [Streptomyces coelicolor]
4KRU_A	1.31e-16	84	272	22	218	X-raystructure of catalytic domain of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
4KRT_A	5.60e-16	84	272	22	218	X-raystructure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101],4KRT_B X-ray structure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
6ZMV_A	1.30e-12	82	280	2	201	ChainA, muramidase [Trichobolus zukalii],6ZMV_B Chain B, muramidase [Trichobolus zukalii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8X7H0	1.50e-40	80	283	65	265	Uncharacterized protein YegX OS=Escherichia coli O157:H7 OX=83334 GN=yegX PE=3 SV=2
P76421	2.30e-39	80	283	65	265	Uncharacterized protein YegX OS=Escherichia coli (strain K12) OX=83333 GN=yegX PE=3 SV=2
Q8FFY2	2.30e-39	80	283	65	265	Uncharacterized protein YegX OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=yegX PE=3 SV=2
P25310	5.21e-23	82	275	82	282	Lysozyme M1 OS=Streptomyces globisporus OX=1908 GN=acm PE=1 SV=1
P26836	6.14e-14	84	280	11	204	Probable autolytic lysozyme OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=lyc PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999944	0.000062	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
45	67