CAZyme Information: MGYG000002439_02762

Basic Information

• Species: CHH4-2 sp002899675
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CHH4-2; CHH4-2 sp002899675
• CAZyme ID: MGYG000002439_02762
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
814	MGYG000002439_12|CGC3	88782.07	5.0089

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002439	6089737	Isolate	Taiwan	Asia

• Gene Location: Start: 45638; End: 48082 Strand: +

Full Sequence      

MEIYKDSTKSVKERVEDLLGRMTLEEKAAQLCGDLPMDLVQNGMPSTELLKKKFPHGHGR
ITQYSTMGVADPMKIAVLSNTLQKYFVEETRLGIPVALQTENLCGYPAKGGTLFPAQINV
SCTWEPELAEAMSGIISEESKAVGINSAMSPVIDVVRDHRWGRVYETYGEDPYLTSQMGI
HYVKGMQKDKKNGVACIAKHFLGYSDSQGGLNTAVCRIPDRELYEVFATPFEAAMREADV
SSVMANYAEIDGMCVAANKKIAHDLLRDTMKFDGILTSDGAGVLKIFKDFKMAESYEEAG
YLAKKAGTDTEIPVGNAFRKLPDYVRAGKLDESVLDESVRRVLKVKFEYGLFDHPYIDLD
KVEESLNNEKKNALSEEIAAKSLVLLKNDGVLPLKKGTKLAVVGPHADNLRYPVSGYTYP
AYVEMLSAGSSGNQVSIGGMADEAQIGNPQSTETPFTAFSRGLTEEEKQSIGDMNEVLRD
MGARTLKETLADRFQVSYARGCGITDEDTTGIADAVKAAEESDVVVMACGGNCGWVNVTG
GEGKDRCSLELPGVQQKLLEAVSAVGKPIVLILYGPGIFALPWACENTAAMIQAWMPGQY
AAKVMADVLDGTGNFGGKLTTTVPRSVGQTPVTYNHRMGSGYASEKNPMGSQIFTGGYVD
QSSQPLFCFGHGLSYTTFELSDFAVEAKEVSTDGTIVVSCAVANTGERQGDEVVQLYYRT
KKAHVVRPVKQLAGFKRVSLEPGEKKKVTFRLKTSQLGYYNEDMEFVVEPTTMDLMVGTS
AHRIDYTEEIALTGEKKDVMGKRSYTCAAVIEEV

Enzyme Prediction     

No EC number prediction in MGYG000002439_02762.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	88	312	4.8e-59	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	4.31e-141	15	784	38	757	beta-glucosidase BglX.
COG1472	BglX	1.16e-75	22	419	1	373	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	2.44e-60	72	784	63	775	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	2.48e-60	23	345	1	316	Glycosyl hydrolase family 3 N terminal domain.
pfam01915	Glyco_hydro_3_C	4.47e-44	383	675	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QAT49116.1	0.0	1	812	1	817
QQA37498.1	0.0	1	806	1	799
SNU95883.1	4.80e-282	3	806	5	803
AFM44649.1	5.39e-209	3	799	10	776
ADQ45097.1	2.63e-207	10	812	2	770

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5YOT_A	1.38e-119	4	784	7	748	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	1.05e-118	4	784	7	748	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5XXL_A	1.07e-109	15	784	14	744	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	5.72e-109	15	784	14	744	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5Z87_A	5.81e-107	4	787	36	780	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KMH0	7.43e-118	6	793	28	721	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
T2KMH9	2.61e-116	4	786	29	747	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
Q56078	2.38e-101	15	784	38	757	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	9.01e-101	15	784	38	757	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
P14002	1.58e-79	91	814	34	687	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002439_02762.