CAZyme Information: MGYG000002439_04181

Basic Information

• Species: CHH4-2 sp002899675
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CHH4-2; CHH4-2 sp002899675
• CAZyme ID: MGYG000002439_04181
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
324	MGYG000002439_24|CGC1	38558	6.7403

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002439	6089737	Isolate	Taiwan	Asia

• Gene Location: Start: 7052; End: 8026 Strand: +

Full Sequence      

MEQQPLVSINCITYNHEEYIRKTLESFLMQKVDFPYEILVHDDASTDKTAEIIREYAEKY
PEIIKPMYQTENQYSKGISNISGAFNFPRARGKYICMCEGDDYWIDPLKMQMQVDYMESH
PDCTLCFHSAKTEVVDGSMTEGKVRPYTEDRIVTPEEIIDKTSGYATASLMFPTKYVKEL
PRYYTDCQVGDIPLQLMMAEHGYGYYMDRDMCVYRVGVSQSWTTASKKGNYKEKQRKYYE
NMKWMYEEFDRVTGGRFHKESVSAAERIYFLTMVNTRQYDQVLRPEFKRYYKELSDRTRF
FIQMEVKAPWLYRLLQKAAYAVRR

Enzyme Prediction     

No EC number prediction in MGYG000002439_04181.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	12	127	7.2e-17	0.6470588235294118

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04196	GT_2_like_d	3.31e-22	13	147	6	132	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd00761	Glyco_tranf_GTA_type	1.45e-20	13	127	5	112	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
pfam00535	Glycos_transf_2	1.23e-18	12	122	5	108	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG0463	WcaA	9.80e-17	4	103	2	95	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd02525	Succinoglycan_BP_ExoA	4.57e-13	6	101	1	91	ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SET96522.1	5.75e-155	2	317	6	321
QRV19558.1	5.38e-146	6	317	10	321
ADL06344.1	5.38e-146	6	317	10	321
ASN93813.1	2.79e-145	6	317	19	330
QJU21876.1	2.79e-145	6	317	19	330

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	7.61e-06	1	103	1	96	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P64864	2.14e-33	7	138	1	128	Uncharacterized protein Mb1547 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=BQ2027_MB1547 PE=4 SV=1
P9WLV4	2.14e-33	7	138	1	128	Uncharacterized protein MT1570 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1570 PE=4 SV=1
P9WLV5	2.14e-33	7	138	1	128	Uncharacterized protein Rv1520 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1520 PE=1 SV=1
Q58457	1.72e-10	4	127	7	125	Uncharacterized glycosyltransferase MJ1057 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1057 PE=3 SV=2
O32268	2.20e-10	4	249	5	243	Putative teichuronic acid biosynthesis glycosyltransferase TuaG OS=Bacillus subtilis (strain 168) OX=224308 GN=tuaG PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002439_04181.