CAZyme Information: MGYG000002439_04362

Basic Information

• Species: CHH4-2 sp002899675
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CHH4-2; CHH4-2 sp002899675
• CAZyme ID: MGYG000002439_04362
• CAZy Family: GH4
• CAZyme Description: Alpha-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
433	MGYG000002439_25|CGC1	48977.42	5.3174

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002439	6089737	Isolate	Taiwan	Asia

• Gene Location: Start: 105333; End: 106634 Strand: +

Full Sequence      

MATKITFLGAGSSVFVRNVLGDCMLHPDMGDLEFALYDIDPVRDQDSYAMLQAINNKFRQ
GKVVIKKYVGLTELPEALTGADFVINAIQVGGYEPCTVTDFEIPKKYGLRQTIADTLGVG
GVFRALRTIPVMQTFADYIGKYCPNAIFLNYTNPMGILTGYMLRYTDVNLVGLCHSVQVA
VPKLMAGVGMDYDDTIQWKIAGINHMAWVLEITKGGKDLYPEIKRRSLEQGAPAEDRVRH
EIMHKFGYYVTESSEHNAEYMPYFIKDKYPELIDRFNIPLDEYPRRCIRHIDEWAEMREK
LINSHEQSKEYAAYIMESVLTNKAFKFGGNVINNGLISNLPPEACVEVPCISDASGITPC
YVGRLPEQLAALNRTNLNVQLLTIEAARTLKKETVYHAVMLDPHTSAELTMDEIISMCDE
MFEAHKDWMPQYK

Enzyme Prediction     

EC	3.2.1.22

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH4	4	181	9.5e-59	0.9553072625698324

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15076	PRK15076	0.0	2	433	1	431	alpha-galactosidase; Provisional
cd05297	GH4_alpha_glucosidase_galactosidase	0.0	3	422	1	423	Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases. linked to 3D####ucture
COG1486	CelF	8.79e-165	1	433	2	440	Alpha-galactosidase/6-phospho-beta-glucosidase, family 4 of glycosyl hydrolase [Carbohydrate transport and metabolism].
pfam11975	Glyco_hydro_4C	3.79e-61	200	405	1	168	Family 4 glycosyl hydrolase C-terminal domain.
cd05296	GH4_P_beta_glucosidase	4.42e-58	4	429	2	419	Glycoside Hydrolases Family 4; Phospho-beta-glucosidase. Some bacteria simultaneously translocate and phosphorylate disaccharides via the phosphoenolpyruvate-dependent phosphotransferase system (PEP-PTS). After translocation, these phospho-disaccharides may be hydrolyzed by the GH4 glycoside hydrolases such as the phospho-beta-glucosidases. Other organisms (such as archaea and Thermotoga maritima ) lack the PEP-PTS system, but have several enzymes normally associated with the PEP-PTS operon. The 6-phospho-beta-glucosidase from Thermotoga maritima hydrolylzes cellobiose 6-phosphate (6P) into glucose-6P and glucose, in an NAD+ and Mn2+ dependent fashion. The Escherichia coli 6-phospho-beta-glucosidase (also called celF) hydrolyzes a variety of phospho-beta-glucosides including cellobiose-6P, salicin-6P, arbutin-6P, and gentobiose-6P. Phospho-beta-glucosidases are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS96820.1	9.69e-219	4	433	3	432
ACL71075.1	8.17e-206	4	433	3	432
BAB05947.1	9.12e-201	4	433	3	434
AHF25587.1	2.70e-200	4	432	3	434
AFH60941.1	5.06e-200	1	433	1	433

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FEF_A	3.27e-31	4	403	7	419	Crystalstructure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_B Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_C Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_D Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis]
5C3M_A	5.91e-31	4	432	6	437	Crystalstructure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_B Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_C Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_D Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
1S6Y_A	1.11e-27	4	432	9	440	2.3Acrystal structure of phospho-beta-glucosidase [Geobacillus stearothermophilus]
1U8X_X	5.48e-26	8	431	33	463	CrystalStructure Of Glva From Bacillus Subtilis, A Metal-requiring, Nad-dependent 6-phospho-alpha-glucosidase [Bacillus subtilis]
6DUX_A	5.24e-22	8	431	11	441	ChainA, 6-phospho-alpha-glucosidase [Klebsiella pneumoniae],6DUX_B Chain B, 6-phospho-alpha-glucosidase [Klebsiella pneumoniae],6DVV_A Chain A, 6-phospho-alpha-glucosidase [Klebsiella pneumoniae],6DVV_B Chain B, 6-phospho-alpha-glucosidase [Klebsiella pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34645	8.52e-190	4	433	3	432	Alpha-galactosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=melA PE=1 SV=1
P06720	3.48e-126	2	430	4	446	Alpha-galactosidase OS=Escherichia coli (strain K12) OX=83333 GN=melA PE=1 SV=1
P30877	9.38e-121	2	432	4	448	Alpha-galactosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=melA PE=3 SV=2
Q9X4Y0	7.68e-63	4	432	5	442	Alpha-galactosidase OS=Rhizobium meliloti (strain 1021) OX=266834 GN=melA PE=3 SV=1
A9KTB9	1.15e-43	4	431	12	462	Alpha-galacturonidase OS=Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) OX=357809 GN=Cphy_3396 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002439_04362.