CAZyme Information: MGYG000002439_04706

Basic Information

• Species: CHH4-2 sp002899675
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CHH4-2; CHH4-2 sp002899675
• CAZyme ID: MGYG000002439_04706
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
333	MGYG000002439_29|CGC2	39256.48	5.192

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002439	6089737	Isolate	Taiwan	Asia

• Gene Location: Start: 68902; End: 69903 Strand: +

Full Sequence      

MTGAQILYEAENDDRYLQSLLRFGDKYVREDGSVTGFRPSEHNVDQLRCGTTFFFLYEQT
GNEKYKKAMELFMDNLKTFPRTEEGSFWHKEIYPYQVWLDGLYMAMPFYLKYDTLYGGKK
HYNDIIDQFKRVRRYQYDEEKQLYYHAYDEKRKMIWADKETGLSPCFWLRAEGWFLMALV
DCYEIIPEESYDQFRYLGALYKEALSGILKYQDQESGLFYQLIDRADLPGNYLETSGSAM
VAYSILKACRLGLLQREKYFEVGEQILTALETKMFSVENKKFHLNGICASAGLGPKDERD
GSPEYYLNEPQKQDNKHGAAACMMAYGEWKRQI

Enzyme Prediction     

No EC number prediction in MGYG000002439_04706.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	2	331	2.4e-97	0.9337349397590361

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	1.27e-82	3	331	44	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	6.68e-76	7	331	41	341	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHQ62178.1	6.82e-125	1	328	34	361
BCJ93648.1	1.24e-119	3	329	35	361
ASN96698.1	6.00e-110	1	330	30	359
QRP38506.1	6.00e-110	1	330	30	359
QJU19057.1	6.53e-109	1	330	30	359

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	1.41e-84	1	330	31	359	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	1.39e-66	1	328	47	363	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	5.88e-66	1	328	37	353	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3QWT_A	2.18e-12	23	270	96	328	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	3.24e-09	23	250	97	310	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	7.60e-66	1	328	47	363	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	6.26e-42	104	328	1	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	6.26e-42	104	328	1	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
O31521	1.66e-20	3	251	39	274	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002439_04706.