CAZyme Information: MGYG000002439_04834

Basic Information

• Species: CHH4-2 sp002899675
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CHH4-2; CHH4-2 sp002899675
• CAZyme ID: MGYG000002439_04834
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglC

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
474	MGYG000002439_32|CGC1	54662.27	4.8151

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002439	6089737	Isolate	Taiwan	Asia

• Gene Location: Start: 12011; End: 13435 Strand: +

Full Sequence      

MDVKFPKEFLWGSATASYQCEGAWDEDGKGLGMWDEFCHSDKNCITYTTGDVASDHYHRF
EEDIKMMAEGGQNTYRFSLAWPRIMPDGTGKVNQKGIEYYRKVIDTCFKYGVEPNVTLYH
WDLPNSLAQKGGWENVETAYAFAEYAKVCFDAFGDQVNLWVTINEPSYFITSGYAIGNYP
PNVKDFQRMIHAAYHVMLASALGVKAFRESKAKGQIGIVHASANVDLYEESEACQKAGRL
ADNYFNNWVLDPPMLGHFPQDLLEKLVEEGFDLSFMKPEHEEILKNGIVDFIGINYYSRA
LIKPYTSGETILKANNTGKKGDDRAELIIKGWFEQAKDPDSEYTAWDCEIYPKGIYDELA
DIRKKYGDVPVYITENGVGMYEKPAESGMVEDDGRIDFLSRHMEEMRRAIRDGFNLKGYY
VWSTFDLYSWINGYEKRYGLVRVDFDDNCRRTPKKSYYWYRDFIRNENQESGGR

Enzyme Prediction     

No EC number prediction in MGYG000002439_04834.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	467	7.5e-158	0.9906759906759907

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00232	Glyco_hydro_1	0.0	5	466	5	450	Glycosyl hydrolase family 1.
COG2723	BglB	9.98e-177	4	466	3	452	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
TIGR03356	BGL	1.85e-171	6	460	1	426	beta-galactosidase.
PRK13511	PRK13511	2.61e-150	1	461	1	460	6-phospho-beta-galactosidase; Provisional
PLN02814	PLN02814	3.83e-96	5	464	28	480	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJA01557.1	1.07e-197	8	472	3	468
AEE90266.1	6.36e-197	7	464	5	461
CDI40268.1	6.36e-197	7	464	5	461
ANU70749.1	1.24e-193	8	471	4	459
QQR25383.1	1.24e-193	8	471	4	459

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Z1H_A	1.61e-145	3	470	9	451	ChainA, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1H_B Chain B, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1M_A Chain A, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_B Chain B, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_C Chain C, Ancestral reconstructed glycosidase [synthetic construct]
5YHS_A	6.02e-139	3	470	1	468	Pyruvylatedbeta-D-galactosidase from Bacillus sp. HMA207, apo form [Bacillus sp. (in: Bacteria)],5YHS_B Pyruvylated beta-D-galactosidase from Bacillus sp. HMA207, apo form [Bacillus sp. (in: Bacteria)]
5YIF_A	4.85e-138	3	470	1	468	Pyruvylatedbeta-D-galactosidase from Bacillus sp. HMA207, E163A mutant pyruvylated beta-D-galactose complex [Bacillus sp. (in: Bacteria)],5YIF_B Pyruvylated beta-D-galactosidase from Bacillus sp. HMA207, E163A mutant pyruvylated beta-D-galactose complex [Bacillus sp. (in: Bacteria)]
4PTV_A	2.39e-135	5	464	7	444	Halothermothrixorenii beta-glucosidase A, thiocellobiose complex [Halothermothrix orenii H 168],4PTV_B Halothermothrix orenii beta-glucosidase A, thiocellobiose complex [Halothermothrix orenii H 168],4PTW_A Halothermothrix orenii beta-glucosidase A, 2-deoxy-2-fluoro-glucose complex [Halothermothrix orenii H 168],4PTW_B Halothermothrix orenii beta-glucosidase A, 2-deoxy-2-fluoro-glucose complex [Halothermothrix orenii H 168],4PTX_A Halothermothrix orenii beta-glucosidase A, glucose complex [Halothermothrix orenii H 168],4PTX_B Halothermothrix orenii beta-glucosidase A, glucose complex [Halothermothrix orenii H 168]
3TA9_A	2.91e-135	5	464	13	450	beta-GlucosidaseA from the halothermophile H. orenii [Halothermothrix orenii H 168],3TA9_B beta-Glucosidase A from the halothermophile H. orenii [Halothermothrix orenii H 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26208	1.47e-124	3	466	4	445	Beta-glucosidase A OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglA PE=1 SV=1
P10482	4.17e-123	1	465	1	452	Beta-glucosidase A OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=bglA PE=3 SV=1
P42403	9.69e-119	5	465	9	471	Aryl-phospho-beta-D-glucosidase BglC OS=Bacillus subtilis (strain 168) OX=224308 GN=bglC PE=1 SV=1
B9K7M5	1.55e-117	4	466	3	439	1,4-beta-D-glucan glucohydrolase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E) OX=309803 GN=gghA PE=1 SV=2
Q97EZ2	1.01e-114	5	461	4	458	6-phospho-beta-galactosidase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=lacG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002439_04834.