CAZyme Information: MGYG000002440_02091

Basic Information

• Species: Enteroscipio rubneri
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Eggerthellaceae; Enteroscipio; Enteroscipio rubneri
• CAZyme ID: MGYG000002440_02091
• CAZy Family: GT28
• CAZyme Description: Processive diacylglycerol beta-glucosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
460	MGYG000002440_15|CGC2	50313.58	7.1799

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002440	2826736	Isolate	Germany	Europe

• Gene Location: Start: 55380; End: 56762 Strand: -

Full Sequence      

MLLGADAPSPLIIVMHASVGSGHRSAANAVAQAFELLRDGSDETLDSSLAATGIDRAAAS
DPACASALSSHAPENEARETMGSACTPHDFDVEVIDVLDFGRIVFDGNKAASLFTGATRP
IYDLTWRFSLTGRLLWGGGTAWNRIMYPAFTDYVREKRPAAIVCTHITAANVATAARMLT
GQRFPIVCVPTDYETEGLWPHRSADLFCVANESMAETLRPRRVPEERILITGIPTRDDFR
RSYNKRATREKMNLPQNKRVVLALAGAYLPRPYVHFREAIDRTLPYLHSLDDSTHVVIVA
GSDAEYARHLRQACAELGVGNATVLDYVDEMAALMAASDLVICKSGGLTVTECLCAQVPM
ILLGKAYGQEKVNVRMLTSVGAAMHVTTARELVDALRHIAANPESVHAMLVNGSFLRRPD
AALDIARATLCLARTPMADDAHYRKHFLQFYWGRKPAHIR

Enzyme Prediction     

No EC number prediction in MGYG000002440_02091.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	278	420	4.9e-27	0.89171974522293

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd17507	GT28_Beta-DGS-like	6.18e-54	12	428	1	358	beta-diglucosyldiacylglycerol synthase and similar proteins. beta-diglucosyldiacylglycerol synthase (processive diacylglycerol beta-glucosyltransferase EC 2.4.1.315) is involved in the biosynthesis of both the bilayer- and non-bilayer-forming membrane glucolipids. This family of glycosyltransferases also contains plant major galactolipid synthase (chloroplastic monogalactosyldiacylglycerol synthase 1 EC 2.4.1.46). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. The structures of the formed glycoconjugates are extremely diverse, reflecting a wide range of biological functions. The members of this family share a common GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
PRK13609	PRK13609	9.75e-35	154	430	100	366	diacylglycerol glucosyltransferase; Provisional
COG0707	MurG	1.50e-33	154	435	87	357	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
PRK13608	PRK13608	5.98e-25	185	432	129	368	diacylglycerol glucosyltransferase; Provisional
cd03785	GT28_MurG	5.02e-23	220	426	146	348	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOS69492.1	1.94e-241	10	460	55	478
BAK44346.1	5.39e-238	6	460	26	465
ACV55211.1	2.29e-235	10	460	100	516
QTU84801.1	1.46e-208	3	460	32	461
BCA88843.1	8.70e-189	10	460	69	483

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1F0K_A	2.46e-07	280	434	198	355	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]
3S2U_A	5.78e-07	322	434	237	356	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54166	1.17e-23	152	412	98	348	Processive diacylglycerol beta-glucosyltransferase OS=Bacillus subtilis (strain 168) OX=224308 GN=ugtP PE=1 SV=1
A8FED1	1.45e-19	177	412	121	348	Processive diacylglycerol beta-glucosyltransferase OS=Bacillus pumilus (strain SAFR-032) OX=315750 GN=ugtP PE=3 SV=1
B9DQ98	2.86e-19	156	409	102	345	Processive diacylglycerol beta-glucosyltransferase OS=Staphylococcus carnosus (strain TM300) OX=396513 GN=ugtP PE=3 SV=1
A7GKY0	7.36e-18	180	430	124	366	Processive diacylglycerol beta-glucosyltransferase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) OX=315749 GN=ugtP PE=3 SV=1
Q65IA4	3.10e-17	154	412	100	348	Processive diacylglycerol beta-glucosyltransferase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=ugtP PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999881	0.000162	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002440_02091.