CAZyme Information: MGYG000002444_00881

Basic Information

• Species: Faecalibacillus faecis
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelatoclostridiaceae; Faecalibacillus; Faecalibacillus faecis
• CAZyme ID: MGYG000002444_00881
• CAZy Family: GH1
• CAZyme Description: 6-phospho-beta-glucosidase BglA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
494	MGYG000002444_3|CGC4	56660.59	4.7125

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002444	2525977	Isolate	South Korea	Asia

• Gene Location: Start: 188844; End: 190328 Strand: +

Full Sequence      

MSLPKDFLWGGATAANQYEGGWNIGRRGKSSDDVITNGTHTEPRCITFVNKSGERVKAPM
FVGADYEDVDHFECFDDCLYPNHEATDFYHHYKEDIALMAEMGFKCFRLSIAWSRIFANG
GMEGEQPLEEGLKFYDDVFDECLKYGIEPLVTLSHYETPLALTEAWNSWADRRTIDCYVR
YCEVVFNRYKNKVKYWLTFNEINCIEMSPWMEGGVLTKDKQTMINMAHYQFVASAKAVKL
GHQINPDFKIGCMLAYTLTYPMTCNPKDTLAAWKNTHNNIFYTDVQCRGYYPSYRLKEFE
REGITLPIEDGDLEIIKEGTVDFLSFSYYISQVAAYNPEDYEGAGGGNLSLGLKNPYLSA
SDWGWQIDSTGLRNALNRLYDRYQMPLFVVENGLGAFDKIEEDGSIHDTYRINYLRDHIK
AMDAAVNEDGVDLMGYTMWGCVDLVSASTGETAKRYGFVHVDKYDDGTGDLSRRRKDSFY
WYKKVIESHGNDLD

Enzyme Prediction     

EC	3.2.1.86	3.2.1.21	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	490	2.8e-142	0.9883449883449883

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	0.0	1	493	2	476	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	0.0	2	494	3	474	cryptic 6-phospho-beta-glucosidase; Provisional
PRK15014	PRK15014	0.0	1	493	4	477	6-phospho-beta-glucosidase BglA; Provisional
COG2723	BglB	0.0	1	494	2	458	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	1	494	4	478	6-phospho-beta-glucosidase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCL59068.1	0.0	1	494	1	494
BBK62627.1	1.53e-226	1	493	1	489
BBK22859.1	1.53e-226	1	493	1	489
QQV06033.1	7.83e-222	1	493	1	489
AGF58526.1	1.37e-215	1	493	1	489

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XHY_A	1.68e-195	1	493	6	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
6WGD_A	1.12e-188	3	493	8	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4F66_A	8.94e-176	3	493	7	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	2.54e-175	3	493	7	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
3PN8_A	3.59e-170	3	493	7	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q46829	9.19e-195	1	493	6	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
P42973	1.44e-181	2	493	3	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
P40740	1.78e-177	3	493	8	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
Q46130	3.11e-169	1	494	5	472	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
P24240	1.49e-167	3	494	4	474	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002444_00881.