CAZyme Information: MGYG000002444_01656

Basic Information

• Species: Faecalibacillus faecis
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelatoclostridiaceae; Faecalibacillus; Faecalibacillus faecis
• CAZyme ID: MGYG000002444_01656
• CAZy Family: GH170
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
389		44531.09	4.91

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002444	2525977	Isolate	South Korea	Asia

• Gene Location: Start: 51622; End: 52791 Strand: +

Full Sequence      

MEKVMLGVSLYPEQEVLEEIDAYLKMASSYGFKKVFTSMFSVSGTKEEVIAYFKDFTKIV
HKYGMVVSGDCNSELFHRLGATETDLSVFKEIGVDILRMDFSFNDERDATLINNKEGIKI
EMSTSFIEIIEAAIKNGAKPENISTCHNFYPERYTAPSLEAINEINNYWKAKNIPVAIFI
SSLVKGSHGPWPVSDGLPTIEEHRDMPIEEQLKHCLALDNVDEIIIGNAYASEDEFKAID
QVMKQVYVDVPKNEAFGFLADFIPHGMIKRVPFKIQLEEGITELEKEILFNYPTHSDLGD
CMNYMLRSRWTRMIYKGKEIPCRPCTKTHYTRGDVVIVNDNLAHYRGEIQIVLKDMKVDG
QRNLLGRIDESEIFILEHIKAKDVFTFVE

Enzyme Prediction     

No EC number prediction in MGYG000002444_01656.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH170	5	251	3.8e-70	0.6857142857142857

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3589	COG3589	2.52e-84	3	389	1	358	Uncharacterized protein [Function unknown].
pfam19200	DUF871_N	3.78e-82	6	239	1	233	DUF871 N-terminal domain. This family consists of several conserved hypothetical proteins from bacteria and archaea. The function of this family is unknown.
pfam05913	DUF871	1.69e-32	271	388	1	116	Bacterial protein of unknown function (DUF871). This family consists of several conserved hypothetical proteins from bacteria and archaea. The function of this family is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMK55490.1	2.31e-169	1	389	15	408
BCL57950.1	2.34e-158	99	332	1	234
QAT39807.1	4.15e-104	6	389	4	362
BBH25090.1	1.52e-101	6	379	4	353
CBK78843.1	8.11e-101	6	387	4	360

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1X7F_A	8.75e-75	6	389	29	385	Crystalstructure of an uncharacterized B. cereus protein [Bacillus cereus ATCC 14579]
2P0O_A	1.66e-20	7	388	6	358	Crystalstructure of a conserved protein from locus EF_2437 in Enterococcus faecalis with an unknown function [Enterococcus faecalis V583]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000076	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002444_01656.