CAZyme Information: MGYG000002444_02199

Basic Information

• Species: Faecalibacillus faecis
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelatoclostridiaceae; Faecalibacillus; Faecalibacillus faecis
• CAZyme ID: MGYG000002444_02199
• CAZy Family: CBM51
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1324		149798.61	4.6525

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002444	2525977	Isolate	South Korea	Asia

• Gene Location: Start: 41632; End: 45606 Strand: +

Full Sequence      

MRKKSKKIISSILGLVVLFQMVCPVSSYAVENGGQETTNESLVMDENTGKDEDNSAQDSS
KDEENIVVMAAHESEDYKYLSDLDYITENNWSYAGWGEIKKDKNIENGQISLLVDGTRIY
FNKGMGAHASSQLTYDVSGFSGTYTRFVSKMGVDASKNGLGEVWFRISASKDGTNWDELY
KSNTVTSKDNALDVDLNIKDYKYLRLYADKNGSNAVDHAVYADSRIVKENYDLSSELFDD
IKKVSYYDEILSKNTVEENYNNHFDTVLKREFVNRMGYWNLQNSIKDDDTGEAKEAIKWI
FNDQKNLQLFIETGNVGDSLKCVSLLKELYSKHKDDLNDQTQGDVYKKMMIALAIAYSTD
KNGSPLSFNMQPNSYDALKRYEIIKDLYDSGLFARKDEFSTYNMELIRMVMNDSISNDEI
YWLRHYSQSRHGTDLNKALNPYNYMRYVSPNYAQDKFYDANNKETYDTKYQLSKYNIPYG
LNSDGTKTSRTWMVMEAGGICWNISRLGQNLNRVYGIPTVGIYQPAHESYFTYSQNSDGK
GIWSIGNNIFGWGQSSSKWYGGNGTRLLLNWNNKSFTRPHMGLKVDLGNGVKSDVGNNGG
YQLLGQAALNNYEAYQKSLYYNLIANSYESATIKEEVYNKALEVLDINLDSFEAILNLYK
QKGDQVTSANWLEFAKRVISTYTYYPMAMTDLLRVINPYLNREDTLEVDMLKTEALNKAL
NATDDEVLQSGACREIARALLGSDKVDLASFSFDGENAGKIVMNSKYDDYDFQVQYSLDG
GNTWETSLEHKIVLSKKQIESITADNDIQVKISGSNQIFTIDILKGENISSKTLAMNDDE
DSFVGKIEFLEYSIDNGKTWKAFDSDTRITGNQKVLARYRAHGVYLSGDSTEYNFTENND
KEKKYVYVKDISYVSSGSSQSGYAAKNMIDASPFTTWHTTWGQVAKDKTYVVSFNEVKYL
SQISYDPAGLNGRIKSAKVYVSLDGQEWTLAGEKTNMANNTARKELVLDESLPAKFVKIE
ATETYGNNEGPNKYVSGTRFNYYEDTTKVYKDPSVEYSVTSLTNKDVVATLQLPSGFKAV
GESTYTFDKNGEHTFTYKDLNNKEKTIEAKVSWIDKEVPTATVEYDITEKTEFAVKATLK
DFSKENVKVLNGDEDGSHTFTKNGEFTFMIQDEAGNIGYVTAKVTWITAKDTEVDDDLYV
KSDDYVVKDDVIKNIDANTSLEELKSKLNTNAKQFKLIKNGQEVDIISTGTILVLDNDRS
YTLVVTGDINGDSFHNQLDLTLLINHLLDRTLIQNEIESMASNMNDDGEIDIVDLSIMNK
KTLN

Enzyme Prediction     

No EC number prediction in MGYG000002444_02199.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM51	79	225	1.1e-26	0.9776119402985075
CBM32	914	1028	3.9e-16	0.8548387096774194

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08305	NPCBM	8.36e-34	76	226	1	135	NPCBM/NEW2 domain. This novel putative carbohydrate binding module (NPCBM) domain is found at the N-terminus of glycosyl hydrolase family 98 proteins. This domain has also been called the NEW2 domain (Naumoff DG. Phylogenetic analysis of alpha-galactosidases of the GH27 family. Molecular Biology (Engl Transl). (2004)38:388-399.)
smart00776	NPCBM	1.23e-19	79	226	6	144	This novel putative carbohydrate binding module (NPCBM) domain is found at the N-terminus of glycosyl hydrolase family 98 proteins.
pfam00754	F5_F8_type_C	2.80e-09	924	1028	13	119	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
pfam00404	Dockerin_1	3.76e-06	1267	1321	1	54	Dockerin type I repeat. The dockerin repeat is the binding partner of the cohesin domain pfam00963. The cohesin-dockerin interaction is the crucial interaction for complex formation in the cellulosome. The dockerin repeats, each bearing homology to the EF-hand calcium-binding loop bind calcium.
cd14256	Dockerin_I	4.82e-05	1267	1321	2	55	Type I dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type I dockerins, which are responsible for anchoring a variety of enzymatic domains to the complex.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCL58565.1	0.0	1	1324	1	1328
QTZ28728.1	3.26e-228	55	1131	113	1176
SQG16429.1	3.26e-228	55	1091	115	1142
QZA21247.1	4.22e-228	73	1091	135	1139
SQF53247.1	4.22e-228	73	1091	135	1139

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7JS4_A	2.82e-11	78	226	612	752	ChainA, F5/8 type C domain protein [Clostridium perfringens ATCC 13124]
2YGL_A	1.88e-08	79	160	191	278	TheX-ray crystal structure of tandem CBM51 modules of Sp3GH98, the family 98 glycoside hydrolase from Streptococcus pneumoniae SP3-BS71 [Streptococcus pneumoniae SP3-BS71],2YGL_B The X-ray crystal structure of tandem CBM51 modules of Sp3GH98, the family 98 glycoside hydrolase from Streptococcus pneumoniae SP3-BS71 [Streptococcus pneumoniae SP3-BS71],2YGM_A The X-Ray Crystal Structure Of Tandem Cbm51 Modules Of Sp3gh98, The Family 98 Glycoside Hydrolase From Streptococcus Pneumoniae Sp3-Bs71, In Complex With The Blood Group B Antigen [Streptococcus pneumoniae SP3-BS71],2YGM_B The X-Ray Crystal Structure Of Tandem Cbm51 Modules Of Sp3gh98, The Family 98 Glycoside Hydrolase From Streptococcus Pneumoniae Sp3-Bs71, In Complex With The Blood Group B Antigen [Streptococcus pneumoniae SP3-BS71]
2VMH_A	2.69e-07	85	226	10	150	Thestructure of CBM51 from Clostridium perfringens GH95 [Clostridium perfringens]
2VMG_A	3.03e-07	85	226	16	156	Thestructure of CBM51 from Clostridium perfringens GH95 in complex with methyl-galactose [Clostridium perfringens]
2VMI_A	4.96e-07	85	226	10	150	Thestructure of seleno-methionine labelled CBM51 from Clostridium perfringens GH95 [Clostridium perfringens]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001720	0.973640	0.023684	0.000345	0.000309	0.000275

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002444_02199.