CAZyme Information: MGYG000002449_00395

Basic Information

• Species: Parabacteroides acidifaciens
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides acidifaciens
• CAZyme ID: MGYG000002449_00395
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
156		17617.89	7.1043

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002449	5100482	Isolate	not provided	not provided

• Gene Location: Start: 42349; End: 42819 Strand: -

Full Sequence      

MKPAQISFVKECLPAALSAGAAFNMNPLVILAQAALESGWGMSDLARESRNFFGLTAYGC
SNAYWHGGKTVLKTSAYSLDFRRYDTRENSFLDFARLIRDCYRRAWQVSNDPEAYAKEIA
YSPYISEQNGDNRETYRHSIIQIARTIQAVIALIEE

Enzyme Prediction     

No EC number prediction in MGYG000002449_00395.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	14	148	5.5e-25	0.96875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	4.54e-22	5	148	43	183	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
pfam01832	Glucosaminidase	1.63e-18	14	94	2	77	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
NF038016	sporang_Gsm	1.89e-16	1	124	158	289	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
PRK05684	flgJ	4.24e-16	7	148	154	298	flagellar assembly peptidoglycan hydrolase FlgJ.
PRK12713	flgJ	9.34e-16	6	152	182	331	flagellar rod assembly protein/muramidase FlgJ; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT50705.1	5.18e-93	1	156	1	156
QUT50226.1	5.90e-51	5	147	4	147
QUT49904.1	1.27e-50	1	150	1	148
ABR43053.1	4.24e-50	7	150	4	147
AST53769.1	4.24e-50	7	150	4	147

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QDN_A	3.97e-09	29	127	26	121	CrystalStructure of the endo-beta-N-acetylglucosaminidase from Thermotoga maritima [Thermotoga maritima MSB8]
4Q2W_A	5.42e-07	23	128	182	274	CrystalStructure of pneumococcal peptidoglycan hydrolase LytB [Streptococcus pneumoniae TIGR4]
3VWO_A	3.00e-06	7	127	3	132	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	3.33e-06	7	127	4	133	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3FI7_A	3.80e-06	5	107	30	143	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9X9J3	7.89e-11	7	150	162	308	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
Q9I4P4	1.59e-09	8	148	242	386	Peptidoglycan hydrolase FlgJ OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=flgJ PE=3 SV=1
P59205	3.78e-06	23	128	550	642	Putative endo-beta-N-acetylglucosaminidase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=lytB PE=1 SV=1
P59206	3.82e-06	23	128	594	686	Putative endo-beta-N-acetylglucosaminidase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=lytB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.988816	0.010965	0.000157	0.000027	0.000016	0.000025

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002449_00395.