CAZyme Information: MGYG000002449_00824

Basic Information

• Species: Parabacteroides acidifaciens
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides acidifaciens
• CAZyme ID: MGYG000002449_00824
• CAZy Family: GH20
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
524	MGYG000002449_6|CGC1	59492.06	6.5697

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002449	5100482	Isolate	not provided	not provided

• Gene Location: Start: 18004; End: 19578 Strand: -

Full Sequence      

MRKLIYLSTLLLLFVLPAMAQQPLFPTPAKVQNGKGSFTIGKNLQIQGNGGYADKLAAAL
PVELKDAGMQSSPANGTIRLELIPDQKMADEAYTLVVEPGSILLQASSESGLFYAKEALL
QLSRFGKGSVRACKIQDQPRYGWRGFMLDESRHFFGKEKVKQYLDIMASLRLNVFHWHLT
DEPGWRIEIKRYPKLTSVGAIGNWHDPKAPAQFYTQDEIKEIVAYAADRQIMVVPEFDMP
GHATSVSRAYPEVSGGGEGKWNGFTFHPCKDETFEFISNVLDEIVALFPSPYIHIGGDEV
HYGNQSWFTDPEIQQFIKDKNLGNEVGLEHYFIRRAADIVASKGKTMIGWDEMIDAGVSP
DKAVIMWWRHDRKHQLVKALENGYRVIMTPRRPFYADFIQYGAHKVGRVWGGYNTVEDIC
RFPETIIHLTRDYEDQLMGLQFSLWTERVADAKRLDFMTFPRLVAVAESAWTPAKSKECS
LFMQKLPYFLQYLDTKGIYYFNPFAPDTTPEPGAPDKEDELKNG

Enzyme Prediction     

No EC number prediction in MGYG000002449_00824.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH20	136	473	8.6e-110	0.973293768545994

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06563	GH20_chitobiase-like	5.44e-165	141	486	1	357	The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This GH20 domain family includes an N-acetylglucosamidase (GlcNAcase A) from Pseudoalteromonas piscicida and an N-acetylhexosaminidase (SpHex) from Streptomyces plicatus. SpHex lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
pfam00728	Glyco_hydro_20	1.36e-143	141	473	1	345	Glycosyl hydrolase family 20, catalytic domain. This domain has a TIM barrel fold.
cd06568	GH20_SpHex_like	4.22e-97	141	474	1	317	A subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the N-acetylhexosaminidase from Streptomyces plicatus (SpHex). SpHex catalyzes the hydrolysis of N-acetyl-beta-hexosaminides. An Asp residue within the active site plays a critical role in substrate-assisted catalysis by orienting the 2-acetamido group and stabilizing the transition state. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself. Proteins belonging to this subgroup lack the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases.
COG3525	Chb	3.69e-93	24	511	136	654	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].
cd06570	GH20_chitobiase-like_1	2.45e-92	141	474	1	299	A functionally uncharacterized subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the chitobiase of Serratia marcescens, a beta-N-1,4-acetylhexosaminidase that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This subgroup lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT50216.1	0.0	1	524	1	524
QLK81785.1	1.57e-253	10	524	22	511
QCQ44390.1	1.57e-253	10	524	22	511
AUI48789.1	2.22e-253	10	524	22	511
QKH85477.1	4.48e-253	10	524	22	511

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7CBN_A	3.27e-97	26	503	17	513	Crystalstructure of beta-N-acetylhexosaminidase Am0868 from Akkermansia muciniphila [Akkermansia muciniphila ATCC BAA-835],7CBO_A Crystal structure of beta-N-acetylhexosaminidase Am0868 from Akkermansia muciniphila in complex with GlcNAc [Akkermansia muciniphila ATCC BAA-835]
6EZR_A	8.04e-82	22	504	140	641	Crystalstructure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi [Vibrio harveyi],6EZR_B Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi [Vibrio harveyi],6EZS_A Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi in complex with N-acetylglucosamine [Vibrio harveyi],6EZS_B Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi in complex with N-acetylglucosamine [Vibrio harveyi],6K35_A Crystal structure of GH20 exo beta-N-acetylglucosaminidase from Vibrio harveyi in complex with NAG-thiazoline [Vibrio harveyi],6K35_B Crystal structure of GH20 exo beta-N-acetylglucosaminidase from Vibrio harveyi in complex with NAG-thiazoline [Vibrio harveyi]
6EZT_A	1.11e-80	22	504	137	638	Crystalstructure of GH20 Exo beta-N-Acetylglucosaminidase D437A inactive mutant from Vibrio harveyi [Vibrio harveyi],6EZT_B Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase D437A inactive mutant from Vibrio harveyi [Vibrio harveyi]
6Q63_A	3.68e-78	91	500	106	536	BT0459[Bacteroides thetaiotaomicron],6Q63_B BT0459 [Bacteroides thetaiotaomicron],6Q63_C BT0459 [Bacteroides thetaiotaomicron]
7DUP_A	1.43e-76	19	500	1	520	ChainA, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVA_A Chain A, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVA_B Chain B, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B2UQG6	2.42e-96	17	503	25	532	Beta-hexosaminidase Amuc_0868 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_0868 PE=1 SV=1
P49008	1.71e-85	53	503	74	535	Beta-hexosaminidase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) OX=242619 GN=nahA PE=3 SV=2
P96155	3.67e-73	24	469	141	603	Beta-hexosaminidase OS=Vibrio furnissii OX=29494 GN=exoI PE=1 SV=1
Q7WUL4	2.43e-61	61	497	55	474	Beta-N-acetylhexosaminidase OS=Cellulomonas fimi OX=1708 GN=hex20 PE=1 SV=1
Q619W7	3.16e-55	52	478	72	506	Beta-hexosaminidase A OS=Caenorhabditis briggsae OX=6238 GN=hex-1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000259	0.999029	0.000194	0.000158	0.000159	0.000150

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002449_00824.