CAZyme Information: MGYG000002449_01593

Basic Information

• Species: Parabacteroides acidifaciens
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides acidifaciens
• CAZyme ID: MGYG000002449_01593
• CAZy Family: PL8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
923	MGYG000002449_14|CGC1	104619.1	5.8264

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002449	5100482	Isolate	not provided	not provided

• Gene Location: Start: 8564; End: 11335 Strand: -

Full Sequence      

MNVRNKVSVFLFSLVAIPLFAQTPQQELERLQQNYIRSLVSNDDGTASLVELLSGIQPET
EIADQVVVELHQRYPFNIEKITAYMETIREDGSWPDIDYNDQKRSGWSVKAHADRVLELA
KLYMAEDGDCHWGPKLQTVIHQAFGYWFREKPVCKNWWYNEIGIPKTLGPAFLLMKNELD
AKEKAAAIEVMENAKFGMTGQNKVWLAGNVLIRGLLQDDFELVKAARDTIVSEITIGTQE
GIRSDWSFHQHGPQQQFGNYGLAFLTEMSSFSGLFAGTVFALNKEQQDILNSFLLNGYRW
IVWRGYMDINALDRQLFHSGQIHKAFSLAFATNALMRGSGAEDISRMNDFLQDNYAPEKE
GSRFTGHKHFWDSDQTIHRSPAWMASVKMASWRVIGTELINEDNLKGFYMADGALYTYCR
GDEYLNIFPFWDWRKIPGITSYESDAPVPAFFRYGEHVRNKTAFVGGVTDGHTGMTAMVL
DRDGLQARKSWIFTDDYVLCLGAGIHSDSTLAVTTSIDQRVKHGDLLRYEHKGWVPVNGT
YTSSPEKQRFFHDNTGYIVLQPATCVAVSEKRSGRWCDFMGSYAPATVEGEIVGLHIEHG
RADNAGYQYLILPASSAEKTAAFSTQDIEVIRNDRSVQAVGLGGCFYVTAYEPQKLDLRY
DLQVDILTPGIYMFRRDRGDWHVEAADPTHKQISLSLNINGRDVKIVFPSSHPLGKSISI
HPFIRAPFVKGIKVDGKSDDWNIPSAVRGLIAPWDGAVKDSTAFYVCHDKKNLYFLYEVS
DTTLVYNNEKTEASVGSSDRVEFFFSKDPEMKTYYCAEIDPQGKVMDYEAHHYRKFDGSW
NFKDLKVATYIGKDSYRVEGSLSLKSLKDLGLVSPEGEIRMGVYRADYFGNKDDQVIWSS
WIVPEATEPDFHIPSSLGILRLE

Enzyme Prediction     

No EC number prediction in MGYG000002449_01593.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL8	367	616	1.2e-65	0.9884169884169884
CBM9	734	909	2.5e-18	0.9230769230769231

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01083	GAG_Lyase	1.32e-145	60	688	3	693	Glycosaminoglycan (GAG) polysaccharide lyase family. This family consists of a group of secreted bacterial lyase enzymes capable of acting on glycosaminoglycans, such as hyaluronan and chondroitin, in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen. These are broad-specificity glycosaminoglycan lyases which recognize uronyl residues in polysaccharides and cleave their glycosidic bonds via a beta-elimination reaction to form a double bond between C-4 and C-5 of the non-reducing terminal uronyl residues of released products. Substrates include chondroitin, chondroitin 4-sulfate, chondroitin 6-sulfate, and hyaluronic acid. Family members include chondroitin AC lyase, chondroitin abc lyase, xanthan lyase, and hyalurate lyase.
pfam02278	Lyase_8	2.65e-87	367	616	1	252	Polysaccharide lyase family 8, super-sandwich domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
pfam08124	Lyase_8_N	9.22e-31	81	364	33	317	Polysaccharide lyase family 8, N terminal alpha-helical domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
cd09620	CBM9_like_3	8.70e-13	734	914	1	197	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily may co-occur with various other domains.
cd00241	DOMON_like	3.21e-05	749	901	7	158	Domon-like ligand-binding domains. DOMON-like domains can be found in all three kindgoms of life and are a diverse group of ligand binding domains that have been shown to interact with sugars and hemes. DOMON domains were initially thought to confer protein-protein interactions. They were subsequently found as a heme-binding motif in cellobiose dehydrogenase, an extracellular fungal oxidoreductase that degrades both lignin and cellulose, and in ethylbenzene dehydrogenase, an enzyme that aids in the anaerobic degradation of hydrocarbons. The domain interacts with sugars in the type 9 carbohydrate binding modules (CBM9), which are present in a variety of glycosyl hydrolases, and it can also be found at the N-terminus of sensor histidine kinases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT47778.1	0.0	1	897	1	897
QDO71119.1	7.75e-269	27	720	26	721
QUT90440.1	1.15e-265	27	720	26	721
QCT78112.1	4.71e-265	5	677	2	659
CAH07300.1	4.71e-265	5	677	2	659

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CB8_A	3.32e-89	77	720	23	677	CHONDROITINASEAC LYASE FROM FLAVOBACTERIUM HEPARINUM [Pedobacter heparinus]
1HM2_A	5.52e-89	77	720	45	699	ACTIVESITE OF CHONDROITINASE AC LYASE REVEALED BY THE STRUCTURE OF ENZYME-OLIGOSACCHARIDE COMPLEXES AND MUTAGENESIS [Pedobacter heparinus],1HM3_A Active Site Of Chondroitinase Ac Lyase Revealed By The Structure Of Enzyme-Oligosaccharide Complexes And Mutagenesis [Pedobacter heparinus],1HMU_A ACTIVE SITE OF CHONDROITINASE AC LYASE REVEALED BY THE STRUCTURE OF ENZYME-OLIGOSACCHARIDE COMPLEXES AND MUTAGENESIS [Pedobacter heparinus],1HMW_A Active Site Of Chondroitinase Ac Lyase Revealed By The Structure Of Enzyme-oligosaccharide Complexes And Mutagenesis [Pedobacter heparinus]
1RWA_A	2.31e-38	156	699	124	714	Crystalstructure of Arthrobacter aurescens chondroitin AC lyase [Paenarthrobacter aurescens],1RWC_A Crystal structure of Arthrobacter aurescens chondroitin AC lyase [Paenarthrobacter aurescens],1RWF_A Crystal structure of Arthrobacter aurescens chondroitin AC lyase in complex with chondroitin tetrasaccharide [Paenarthrobacter aurescens],1RWG_A Crystal structure of Arthrobacter aurescens chondroitin AC lyase in complex with chondroitin tetrasaccharide [Paenarthrobacter aurescens],1RWH_A Crystal structure of Arthrobacter aurescens chondroitin AC lyase in complex with chondroitin tetrasaccharide [Paenarthrobacter aurescens]
1RW9_A	2.31e-38	156	699	124	714	Crystalstructure of the Arthrobacter aurescens chondroitin AC lyase [Paenarthrobacter aurescens]
2WCO_A	5.49e-31	156	642	139	668	Structuresof the Streptomyces coelicolor A3(2) Hyaluronan Lyase in Complex with Oligosaccharide Substrates and an Inhibitor [Streptomyces coelicolor A3(2)],2WDA_A The X-ray structure of the Streptomyces coelicolor A3 Chondroitin AC Lyase in Complex with Chondroitin sulphate [Streptomyces violaceoruber]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q59288	3.02e-88	77	720	45	699	Chondroitinase-AC OS=Pedobacter heparinus (strain ATCC 13125 / DSM 2366 / CIP 104194 / JCM 7457 / NBRC 12017 / NCIMB 9290 / NRRL B-14731 / HIM 762-3) OX=485917 GN=cslA PE=1 SV=1
Q9AQS0	1.23e-25	81	640	53	674	Xanthan lyase OS=Bacillus sp. (strain GL1) OX=84635 GN=xly PE=1 SV=1
Q59801	7.72e-23	156	676	182	755	Hyaluronate lyase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=hysA PE=3 SV=1
Q53591	4.21e-18	85	640	291	925	Hyaluronate lyase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=hylB PE=1 SV=2
Q8A2I1	9.62e-11	376	636	606	876	Chondroitin sulfate ABC exolyase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=chonabc PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000339	0.998915	0.000203	0.000181	0.000181	0.000158

TMHMM  Annotations     

start	end
7	24