CAZyme Information: MGYG000002449_02176

Basic Information

• Species: Parabacteroides acidifaciens
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides acidifaciens
• CAZyme ID: MGYG000002449_02176
• CAZy Family: PL8
• CAZyme Description: Chondroitinase-AC

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
722		82135.62	7.3506

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002449	5100482	Isolate	not provided	not provided

• Gene Location: Start: 65272; End: 67440 Strand: +

Full Sequence      

MMKRNLMKLMCWFILLFCFQTIMGKTDSDIEKLRKLFAEQAMKPIINEEKINTLLESIQP
DGTWPGIDYVDTTRTAFQHERHLGNMLALSIAYKKNGSLYKGNKQVRKAIHQSLAFWLAN
DFICENWWWNQIGTPNVMVSMLLILDKELSQEESTRMLKIAERGNINAWGARPSGDRIKI
AGLQAKAALFKRDAEEVAMLMKIIEGEIKFSTERGMQHDFSFHHRTDWVNNTLSYGSGYA
SAFIEWASNVADTKFRFSDQAVRLLIDYYIDGICKQMIYGKISDPGILNRDITRPGEEKV
WGPSDPEKLKNLTNYRQAELENIICLRRGDPSCRPASFAKFFWRTDHFVFQRPDFYTSVR
MYSTRNANMEEPYNGEGLMNHFRGDGTNYLSVRGDEYKRLTPVCDWMKIPGATIVQLDKM
PGENEVQKWGLTDFVGAVTDGLYGAVGFNFKSPHTGLAAKKAWFFFDKEYVCLGTDISSR
MKYPVSTTVNQCILNGEVTVSETKGIDVQKQGVRNIDGAQWVIHDKVGYYFPQKENITLL
NQKVSGSWSIANRQTSTPKETVEQEVFTLSIDHGAHPDKGDYAYIVIPSTDRSSIERQVR
EAGIVTLANNKELQAVRHDGLNMAYAVFYKGGTLHVNEKIVVTMDSPGMLMLKYSESGEI
LTWGVADPTHFLKKIHWSVNQKLGDSGQECIQSEWDESTGSSRIAVDLPQGEYAGKSIVY
HK

Enzyme Prediction     

No EC number prediction in MGYG000002449_02176.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL8	340	589	2.7e-77	0.9879518072289156

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01083	GAG_Lyase	7.68e-108	29	668	1	693	Glycosaminoglycan (GAG) polysaccharide lyase family. This family consists of a group of secreted bacterial lyase enzymes capable of acting on glycosaminoglycans, such as hyaluronan and chondroitin, in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen. These are broad-specificity glycosaminoglycan lyases which recognize uronyl residues in polysaccharides and cleave their glycosidic bonds via a beta-elimination reaction to form a double bond between C-4 and C-5 of the non-reducing terminal uronyl residues of released products. Substrates include chondroitin, chondroitin 4-sulfate, chondroitin 6-sulfate, and hyaluronic acid. Family members include chondroitin AC lyase, chondroitin abc lyase, xanthan lyase, and hyalurate lyase.
pfam02278	Lyase_8	1.55e-92	340	591	2	252	Polysaccharide lyase family 8, super-sandwich domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
pfam08124	Lyase_8_N	9.58e-15	21	298	9	290	Polysaccharide lyase family 8, N terminal alpha-helical domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
pfam02884	Lyase_8_C	1.13e-13	607	675	1	66	Polysaccharide lyase family 8, C-terminal beta-sandwich domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT50612.1	0.0	20	722	363	1065
SCD21938.1	1.58e-223	26	718	25	738
AEL27150.1	1.33e-222	21	719	33	730
AKP52686.1	1.47e-221	28	719	39	729
QGY42588.1	7.06e-219	4	718	2	736

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1HM2_A	2.45e-89	22	718	20	697	ACTIVESITE OF CHONDROITINASE AC LYASE REVEALED BY THE STRUCTURE OF ENZYME-OLIGOSACCHARIDE COMPLEXES AND MUTAGENESIS [Pedobacter heparinus],1HM3_A Active Site Of Chondroitinase Ac Lyase Revealed By The Structure Of Enzyme-Oligosaccharide Complexes And Mutagenesis [Pedobacter heparinus],1HMU_A ACTIVE SITE OF CHONDROITINASE AC LYASE REVEALED BY THE STRUCTURE OF ENZYME-OLIGOSACCHARIDE COMPLEXES AND MUTAGENESIS [Pedobacter heparinus],1HMW_A Active Site Of Chondroitinase Ac Lyase Revealed By The Structure Of Enzyme-oligosaccharide Complexes And Mutagenesis [Pedobacter heparinus]
1CB8_A	2.88e-89	43	718	19	675	CHONDROITINASEAC LYASE FROM FLAVOBACTERIUM HEPARINUM [Pedobacter heparinus]
6F2P_A	2.37e-31	52	669	46	697	Structureof Paenibacillus xanthan lyase to 2.6 A resolution [Paenibacillus]
1X1H_A	2.57e-31	89	669	78	698	ChainA, xanthan lyase [Bacillus sp. GL1],1X1I_A Chain A, xanthan lyase [Bacillus sp. GL1],1X1J_A Chain A, xanthan lyase [Bacillus sp. GL1]
2E22_A	4.53e-31	89	669	78	698	Crystalstructure of xanthan lyase in complex with mannose [Bacillus sp. GL1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q59288	1.34e-88	22	718	20	697	Chondroitinase-AC OS=Pedobacter heparinus (strain ATCC 13125 / DSM 2366 / CIP 104194 / JCM 7457 / NBRC 12017 / NCIMB 9290 / NRRL B-14731 / HIM 762-3) OX=485917 GN=cslA PE=1 SV=1
Q9AQS0	3.53e-30	89	669	103	723	Xanthan lyase OS=Bacillus sp. (strain GL1) OX=84635 GN=xly PE=1 SV=1
Q54873	4.36e-20	27	616	309	944	Hyaluronate lyase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=SP_0314 PE=1 SV=2
Q59801	3.20e-13	126	653	182	754	Hyaluronate lyase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=hysA PE=3 SV=1
C5G6D7	2.20e-11	351	668	608	931	Chondroitin sulfate ABC exolyase OS=Bacteroides thetaiotaomicron OX=818 GN=chonabc PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000200	0.999217	0.000152	0.000143	0.000140	0.000133

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002449_02176.