CAZyme Information: MGYG000002449_02636

Basic Information

• Species: Parabacteroides acidifaciens
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides acidifaciens
• CAZyme ID: MGYG000002449_02636
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
371		42681.17	6.5972

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002449	5100482	Isolate	not provided	not provided

• Gene Location: Start: 17596; End: 18711 Strand: +

Full Sequence      

MKYIIQFFAAICLFMFSVQSVSAQKDYFKDLPAECSPQKVGTILSQRFIPSKHMLHGGKW
IHYAEVCTWYGALRYAEAAGDKKLVKQLQDRFDLLFTTEKAYQPIMNHVDLNMFGCLPLE
FYKVTNDKKYLELGMPYADTQWTLPAGATPEEKAWADKGLSWQTRLWIDDMFMITIVQAQ
AYHATGKREYIDRAAKEMVVYLNELQRPNGLFYHAPDVPYFWARGNGWMAAGMAELLLST
PKDNPDRARILEGYRLMMKNLKDYQSESGMWNQLVDKADCWPETSGSAMFTYAMIMGVKK
GWLDAAEYGPVARKAWIALVPYINKDGDVEEVCVGTNKQNDLQYYYDRPRVAGDFHGQAP
MLWCTYALLCE

Enzyme Prediction     

No EC number prediction in MGYG000002449_02636.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	61	367	5.8e-76	0.9518072289156626

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	1.73e-50	68	364	34	335	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	1.86e-48	47	362	26	347	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCA52191.1	2.44e-187	13	369	9	365
QUT73021.1	2.44e-187	13	369	9	365
QUT40870.1	2.44e-187	13	369	9	365
ALJ39814.1	2.00e-186	13	369	9	365
QDW23918.1	2.94e-186	10	369	7	366

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K11_A	1.28e-38	166	363	199	405	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
1NC5_A	1.75e-31	62	357	40	353	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	7.49e-31	62	357	30	343	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
5NOA_A	2.28e-21	167	316	158	321	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	1.59e-18	167	316	141	304	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	9.56e-31	62	357	40	353	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
T2KPL9	1.15e-16	121	329	122	339	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
L7P9J4	2.84e-16	128	329	131	340	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
P9WF04	4.78e-16	48	345	77	396	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
P0A3U6	4.59e-12	178	362	6	222	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000196	0.999232	0.000149	0.000146	0.000131	0.000126

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002449_02636.