CAZyme Information: MGYG000002449_03330

Basic Information

• Species: Parabacteroides acidifaciens
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides acidifaciens
• CAZyme ID: MGYG000002449_03330
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
371	MGYG000002449_51|CGC1	43071.98	6.3893

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002449	5100482	Isolate	not provided	not provided

• Gene Location: Start: 29679; End: 30794 Strand: +

Full Sequence      

MNKYIWLLVLFVFPASGFSQKEWTKKQVVDIIYRVNDHWQAQNPVPERAFWDNAAYHTGN
MEAYFLTGKESYLRYSEAWAEHNEWKGAKSDDKANWKYSYGETDEYVLFGDWQICFQTYA
DLYLLQPDPKKIARAREVMEYQMSTTRNDYWWWADGLYMVMPVMTKLYKITRDPLYLEKL
HEYFNYANSIMYDKDACLYYRDAKYVYPKHTSVNGKKDFWARGDGWVLAGLAKILKELPQ
ADTHRVEYLCRFRKMAKAVVDCQQPEGYWTRSMLDPAHAPGPETSGTAFFTYALLWGVNN
GYLDQEVYLPAALKGWDYLTTVALQADGKVGYVQPIGEKAIPGQVVNAGSTSNFGVGAFL
LAACEMCRFLD

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	43	367	1.1e-79	0.9759036144578314

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	2.56e-97	23	370	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	4.35e-40	59	368	44	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKZ13508.1	6.71e-216	1	371	1	372
QUT89978.1	4.41e-215	1	371	1	374
ALJ58906.1	2.55e-214	1	371	1	374
QDO67477.1	1.20e-212	1	371	1	374
ANU59603.1	1.10e-211	2	371	3	376

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NOA_A	7.70e-212	15	371	20	376	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	9.34e-175	15	371	3	359	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
4CE7_A	1.97e-55	39	368	39	368	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
1NC5_A	6.01e-15	35	366	25	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	2.49e-14	35	366	15	354	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L7P9J4	2.35e-55	1	368	1	375	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
T2KPL9	6.51e-55	2	368	3	374	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
P9WF04	7.08e-44	140	366	188	408	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O34559	3.29e-14	35	366	25	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000446	0.998727	0.000288	0.000178	0.000173	0.000163

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002449_03330.