CAZyme Information: MGYG000002449_03653

Basic Information

• Species: Parabacteroides acidifaciens
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides acidifaciens
• CAZyme ID: MGYG000002449_03653
• CAZy Family: GH84
• CAZyme Description: O-GlcNAcase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
831		93380.88	5.4956

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002449	5100482	Isolate	not provided	not provided

• Gene Location: Start: 6314; End: 8809 Strand: +

Full Sequence      

MKLLNLTAALLLGGALQAQNPLPVIHPQPQMVMPSVNPLKAPHGFILSGMKNPDPDAIRL
LRETLSITDEPDALPLEITIEGQAPEPKRSGAYRLIINHTGVYIVAPDSRGLFYAAQTLR
QLVQTDKQGNQTLPICTIIDYPDVAFRGTVEGFYGDPWSHADRIEQLRFYGKMKMNTYIY
GPKDDPYHSSPNWRKPYPEKEAAQIKDLVKEAAANKVDFVWAIHPGLDIQWTDEDRMNVL
NKFGMMYDLGVRSFAVFFDDISGEGAKADKQADLLNFLQKEFIEKKAGVSPLIMCPTEYN
RAWAGSDYLDVLGRTLDPAIHVMWTGNSVIHDITLEGQEWVNKRIQRPSYVWWNFPVSDY
CRDHLLMGPSYGLDPEAAHAMSGFVANPMERAEASKVALFGVADYAWNMKAYNPESNFTD
ACRFILPEAPEAFRTFCENNCDPGPNGHRYRRDESVRYAGDAETFLRDFRRHSYNTEAAD
RMNQLFAEITAAPAAIETSSNKALIDEIKPWLMQFHLLGKAGQTALAVASAGQGEDRAAT
WQTYLSLTSLLDSMRIIDRTYNQNPYQKGVKTGSRVLTPFVQEIYLQTGRDLLFPDQADQ
AAAQMSKASILTDIEQLKYQPLKESADQIGYNRLNEVLRIEPGQSFGLAWELQKEATSFS
FSLPKSENSGRLFEWSADGKTWTAITGIPADQPRFKLEQIAPEARYIRMRNTTDKQMQIY
LYDFTVTTKEDTSIDPARLMYDKNLESVNTLPAGSRIAIDSNKGSSLELYLSGSSRSHIV
VEGTPLKGKTKQVLYSGPAGYIKLDKEALEKAKKVELCNEGPDDVRIHEVI

Enzyme Prediction     

No EC number prediction in MGYG000002449_03653.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH84	147	437	2e-111	0.9932203389830508

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07555	NAGidase	7.19e-174	147	436	1	293	beta-N-acetylglucosaminidase. This family has previously been described as a hyaluronidase. However, more recently it has been shown that this family has beta-N-acetylglucosaminidase activity.
pfam02838	Glyco_hydro_20b	3.43e-13	23	140	2	123	Glycosyl hydrolase family 20, domain 2. This domain has a zincin-like fold.
COG3525	Chb	3.32e-06	88	148	203	265	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].
pfam18344	CBM32	0.001	612	661	14	63	Carbohydrate binding module family 32. This domain is found in GH84C present in Clostridium perfringens. GH84C is a beta-N-acetylglucosaminidase. This domain is a family 32 carbohydrate binding module (CBM) which preferentially recognizes the non-reducing terminus of N-acetyllactosamine.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT47835.1	0.0	1	830	1	830
QRO16908.1	0.0	25	831	29	835
ABR42905.1	0.0	25	831	29	835
QUT54259.1	0.0	25	831	29	835
QUT18960.1	0.0	25	831	29	835

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VVN_A	1.09e-188	2	730	5	736	BtGH84in complex with NH-Butylthiazoline [Bacteroides thetaiotaomicron VPI-5482],2VVN_B BtGH84 in complex with NH-Butylthiazoline [Bacteroides thetaiotaomicron VPI-5482],2VVS_A BtGH84 structure in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482],2X0H_A BtGH84 Michaelis complex [Bacteroides thetaiotaomicron VPI-5482],2X0H_B BtGH84 Michaelis complex [Bacteroides thetaiotaomicron VPI-5482],4AIS_A A complex structure of BtGH84 [Bacteroides thetaiotaomicron VPI-5482],4AIS_B A complex structure of BtGH84 [Bacteroides thetaiotaomicron VPI-5482],7OU8_AAA Chain AAA, O-GlcNAcase BT_4395 [Bacteroides thetaiotaomicron VPI-5482],7OU8_BBB Chain BBB, O-GlcNAcase BT_4395 [Bacteroides thetaiotaomicron VPI-5482]
2J4G_A	1.52e-188	25	730	4	714	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with n-butyl- thiazoline inhibitor [Bacteroides thetaiotaomicron VPI-5482],2J4G_B Bacteroides thetaiotaomicron GH84 O-GlcNAcase in complex with n-butyl- thiazoline inhibitor [Bacteroides thetaiotaomicron VPI-5482]
2JIW_A	1.57e-188	25	730	5	715	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with 2- Acetylamino-2-deoxy-1-epivalienamine [Bacteroides thetaiotaomicron VPI-5482],2JIW_B Bacteroides thetaiotaomicron GH84 O-GlcNAcase in complex with 2- Acetylamino-2-deoxy-1-epivalienamine [Bacteroides thetaiotaomicron VPI-5482]
2J47_A	1.57e-188	25	730	5	715	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with a imidazole-pugnac hybrid inhibitor [Bacteroides thetaiotaomicron VPI-5482],2W4X_A BtGH84 in complex with STZ [Bacteroides thetaiotaomicron VPI-5482],2W66_A BtGH84 in complex with HQ602 [Bacteroides thetaiotaomicron VPI-5482],2W66_B BtGH84 in complex with HQ602 [Bacteroides thetaiotaomicron VPI-5482],2W67_A BtGH84 in complex with FMA34 [Bacteroides thetaiotaomicron VPI-5482],2W67_B BtGH84 in complex with FMA34 [Bacteroides thetaiotaomicron VPI-5482],2WCA_A BtGH84 in complex with n-butyl pugnac [Bacteroides thetaiotaomicron VPI-5482],2XJ7_A BtGH84 in complex with 6-acetamido-6-deoxy-castanospermine [Bacteroides thetaiotaomicron VPI-5482],2XJ7_B BtGH84 in complex with 6-acetamido-6-deoxy-castanospermine [Bacteroides thetaiotaomicron VPI-5482],2XM1_A BtGH84 in complex with N-acetyl gluconolactam [Bacteroides thetaiotaomicron VPI-5482],2XM1_B BtGH84 in complex with N-acetyl gluconolactam [Bacteroides thetaiotaomicron VPI-5482],2XM2_A BtGH84 in complex with LOGNAc [Bacteroides thetaiotaomicron VPI-5482],2XM2_B BtGH84 in complex with LOGNAc [Bacteroides thetaiotaomicron VPI-5482],4UR9_A Structure of ligand bound glycosylhydrolase [Bacteroides thetaiotaomicron],4UR9_B Structure of ligand bound glycosylhydrolase [Bacteroides thetaiotaomicron],5FKY_A Structure of a hydrolase bound with an inhibitor [Bacteroides thetaiotaomicron],5FKY_B Structure of a hydrolase bound with an inhibitor [Bacteroides thetaiotaomicron],5FL0_A Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL0_B Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL1_A Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL1_B Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron]
7K41_A	1.73e-188	25	730	8	718	ChainA, O-GlcNAcase BT_4395 [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q89ZI2	5.98e-188	2	730	5	736	O-GlcNAcase BT_4395 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4395 PE=1 SV=1
Q0TR53	1.10e-87	30	440	40	482	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
Q8XL08	2.88e-87	30	440	40	482	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1
P26831	3.58e-49	104	733	145	801	Hyaluronoglucosaminidase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagH PE=1 SV=2
O60502	1.26e-38	148	421	63	348	Protein O-GlcNAcase OS=Homo sapiens OX=9606 GN=OGA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000404	0.998855	0.000221	0.000179	0.000162	0.000150

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002449_03653.