CAZyme Information: MGYG000002449_03716

Basic Information

• Species: Parabacteroides acidifaciens
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides acidifaciens
• CAZyme ID: MGYG000002449_03716
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
409	MGYG000002449_69|CGC1	47244.98	5.8356

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002449	5100482	Isolate	not provided	not provided

• Gene Location: Start: 12812; End: 14041 Strand: +

Full Sequence      

MIIRCLFIKALLLVSLFGMGQEVSKEDVLSTICRVADHVIQQTTYRYYDQADGKQIDDLS
CYGYNKYVVPQNGYNDWKYWNGVIHLSFNALGKITGIERYQNYTKKNFEFFFKDRPYLKS
IYKGNDQWHFPVAQGINITQLDDCGAMGASLIELYENNRVVAYKEYIDMAADYIMYRQQR
LDDGTFSRPVPYNHTVWADDLYMSVPFLIRMWKLTGIELYMEEAVNQIFLFDKHLYDEKV
GLMWHCYYDDLKVNGGTYWGRCNGWMMVAIADLLRFLPENHSRRNEVIALLNRQIQNLAQ
YQSASGLWHQILNKEDSYLETSCSAMFVYSIALAINNGWVDKRYKTIALTGWNGLLTCIT
DEGAVTGICAGTGIGNDVKFYYDRPTPYNDIHGLGAMLLAGVEVSKLLD

Enzyme Prediction     

No EC number prediction in MGYG000002449_03716.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	74	405	6.4e-95	0.9668674698795181

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	9.17e-81	47	408	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	4.22e-70	75	408	32	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKJ31959.1	4.99e-119	17	406	17	401
AFN73321.1	4.94e-115	4	407	3	408
QTE38638.1	6.57e-113	20	406	18	400
ACU02673.1	2.49e-111	5	404	5	398
AKD05935.1	7.30e-110	5	407	4	412

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K11_A	3.46e-64	18	409	22	415	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
1NC5_A	1.10e-37	75	407	37	367	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	4.66e-37	75	407	27	357	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3QWT_A	6.03e-33	155	385	122	358	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
4WU0_A	2.14e-32	113	407	42	361	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	6.03e-37	75	407	37	367	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
O31521	1.50e-24	146	395	77	324	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
P9WF04	1.45e-20	197	404	201	408	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000233	0.999105	0.000184	0.000149	0.000154	0.000148

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002449_03716.