CAZyme Information: MGYG000002449_03721

Basic Information

• Species: Parabacteroides acidifaciens
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides acidifaciens
• CAZyme ID: MGYG000002449_03721
• CAZy Family: GH109
• CAZyme Description: Inositol 2-dehydrogenase/D-chiro-inositol 3-dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
456	MGYG000002449_69|CGC1	50774.86	7.1079

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002449	5100482	Isolate	not provided	not provided

• Gene Location: Start: 20056; End: 21426 Strand: +

Full Sequence      

MKRRDFLTNTALLGAGIPLGMTSAVMTSCSSPQGGDAPAPKTYTPEELGMYSFVEVAPDG
KPLKAALVGCGDRGTGAATQFLSAGPNVSIIALADLFPDRMNSCRKVLKEKFNNEVPDAN
CFLGFDAYKKVLAMNEIDVVLLCTPTHFRPEQFKAAVEAGKNIFMEKPCAVDPTGIRTVI
AAAKVATSKGLTVITGTQRRHRRDYWEAFVQVKNGLIGDIVSSTAHWDQGAWWNKRKRPE
WSDMEYCIRNWFNIKWLSGDHLLDQAVHNIDIVTWFMEDRPVRAVGFGGRAQRLTGDIFD
FFSVDYYYNNNKRMLATARQIDGCDGNVSEQVYGTKGMAQLNDRGEIKIVDYNGNVLWEY
DYKNKPVKNPYDQEHVHLVESIRLNKKINQAEALAYSTQVAILGREAAYTGKPISWDEIM
ASTLHYGPETYEMGPLPFYKEGQAPVPGKAPDAPVM

Enzyme Prediction     

No EC number prediction in MGYG000002449_03721.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	63	227	5.2e-21	0.39598997493734334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	6.43e-37	60	418	1	342	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	1.62e-12	63	196	1	119	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
PRK10206	PRK10206	1.63e-11	131	337	59	242	putative oxidoreductase; Provisional
pfam02894	GFO_IDH_MocA_C	9.93e-07	211	415	3	203	Oxidoreductase family, C-terminal alpha/beta domain. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
PRK11579	PRK11579	3.85e-06	137	267	65	186	putative oxidoreductase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SCM55249.1	3.28e-284	1	455	1	454
QRX64436.1	6.79e-269	1	451	1	449
SCM56422.1	2.17e-150	1	449	7	449
BBD44694.1	1.63e-147	1	449	7	449
SCD21857.1	8.30e-146	3	450	10	450

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CEA_A	1.64e-13	61	350	7	274	ChainA, Myo-inositol 2-dehydrogenase [Lactiplantibacillus plantarum WCFS1],3CEA_B Chain B, Myo-inositol 2-dehydrogenase [Lactiplantibacillus plantarum WCFS1],3CEA_C Chain C, Myo-inositol 2-dehydrogenase [Lactiplantibacillus plantarum WCFS1],3CEA_D Chain D, Myo-inositol 2-dehydrogenase [Lactiplantibacillus plantarum WCFS1]
4N54_A	3.14e-12	61	354	13	287	ChainA, Inositol dehydrogenase [Lacticaseibacillus casei BL23],4N54_B Chain B, Inositol dehydrogenase [Lacticaseibacillus casei BL23],4N54_C Chain C, Inositol dehydrogenase [Lacticaseibacillus casei BL23],4N54_D Chain D, Inositol dehydrogenase [Lacticaseibacillus casei BL23]
4MKX_A	3.20e-12	61	354	16	290	ChainA, Inositol dehydrogenase [Lacticaseibacillus casei BL23],4MKZ_A Chain A, Inositol dehydrogenase [Lacticaseibacillus casei BL23]
4HKT_A	3.80e-10	63	349	4	259	Crystalstructure of a putative myo-inositol dehydrogenase from Sinorhizobium meliloti 1021 (Target PSI-012312) [Sinorhizobium meliloti 1021],4HKT_B Crystal structure of a putative myo-inositol dehydrogenase from Sinorhizobium meliloti 1021 (Target PSI-012312) [Sinorhizobium meliloti 1021],4HKT_C Crystal structure of a putative myo-inositol dehydrogenase from Sinorhizobium meliloti 1021 (Target PSI-012312) [Sinorhizobium meliloti 1021],4HKT_D Crystal structure of a putative myo-inositol dehydrogenase from Sinorhizobium meliloti 1021 (Target PSI-012312) [Sinorhizobium meliloti 1021]
3HNP_A	3.17e-08	130	321	59	229	CrystalStructure of an Oxidoreductase from Bacillus cereus. Northeast Structural Genomics Consortium target id BcR251 [Bacillus cereus ATCC 14579],3HNP_B Crystal Structure of an Oxidoreductase from Bacillus cereus. Northeast Structural Genomics Consortium target id BcR251 [Bacillus cereus ATCC 14579],3HNP_C Crystal Structure of an Oxidoreductase from Bacillus cereus. Northeast Structural Genomics Consortium target id BcR251 [Bacillus cereus ATCC 14579],3HNP_D Crystal Structure of an Oxidoreductase from Bacillus cereus. Northeast Structural Genomics Consortium target id BcR251 [Bacillus cereus ATCC 14579],3HNP_E Crystal Structure of an Oxidoreductase from Bacillus cereus. Northeast Structural Genomics Consortium target id BcR251 [Bacillus cereus ATCC 14579],3HNP_F Crystal Structure of an Oxidoreductase from Bacillus cereus. Northeast Structural Genomics Consortium target id BcR251 [Bacillus cereus ATCC 14579]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O05389	6.84e-11	61	387	3	303	Uncharacterized oxidoreductase YrbE OS=Bacillus subtilis (strain 168) OX=224308 GN=yrbE PE=3 SV=2
O68965	4.86e-10	63	349	3	258	Inositol 2-dehydrogenase OS=Rhizobium meliloti (strain 1021) OX=266834 GN=idhA PE=1 SV=2
A1S4U5	1.88e-09	21	237	17	221	Glycosyl hydrolase family 109 protein OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) OX=326297 GN=Sama_1194 PE=3 SV=1
Q89ZX8	4.32e-08	56	171	50	162	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4243 PE=3 SV=1
A8H2K3	7.43e-08	1	250	3	238	Glycosyl hydrolase family 109 protein OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) OX=398579 GN=Spea_1465 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as TATLIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	0.000470	0.000154	0.999383	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002449_03721.