CAZyme Information: MGYG000002452_01385

Basic Information

• Species: Akkermansia muciniphila_C
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Verrucomicrobiales; Akkermansiaceae; Akkermansia; Akkermansia muciniphila_C
• CAZyme ID: MGYG000002452_01385
• CAZy Family: GH84
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
989	MGYG000002452_2|CGC3	107429.07	9.4992

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002452	2902150	Isolate	China	Asia

• Gene Location: Start: 198496; End: 201465 Strand: +

Full Sequence      

MAAVTALGASLALPVFAQSSSPSSSSSPAASRAKKAARMPVYPIPQKMTRSGGSVTVPAL
KLSGARDEPTVNALKSMFSITPNGLPVQMSIIKGGKKPAGNVPQKAGAYSLSVTPQGIRM
TGYDDEGLFYAAQTLLQLAEKTPSGVTLPVVEVLDWPDVPFRGTIEGFYGLPWGQEGRIS
QFKFYGKYKMNTYIYGPKDDVFHGFSKRWREPYPADMAKDLKELVKVAKQNKVNFVWAVH
PGADIHWGEADRKAAVKKFEMMYDLGFRSFAVFFDDIGGEGAKPEGQVEFLNYLNKEFIH
KKPDVTPLIVCPTAYSGGGGRYHEVMGEHLDKDIGIMWTGSGIVSDIKTPALKGINKYLQ
RPAFIWWNFPVTDYVRHALFLGRTYGVDADAMPFMQGFASNPMDKPEASKISLFSVANMT
WNAKAYDSDKTWRDSIRILFPGCASAMQTFADHNSDGGPSGHNYRKEESVEIAPVVEEVL
ELCRRGGKVSESKAFDRLKTEFARMAQAPDMIRAKANNAAFIAEVEPWLVQFESLGKAGV
NSMQMIEATEAGNASGALNYAMEAACLLAEMQRYSKEISKAINKHVTEVTKKSSQWQTAV
KPSELVMAPAVRELLDMGSTPVLSRVSGQSVGRVKPYVSTKSKGGIEKMLDDDPESYYYC
KEVQKKGDFFGVDLGAPREIRNVSIVMGRNDSDKDAVNKGQLEVSMDGQSWSPLMPESSG
VRVEYEGRGKKGRFVRYRATVQGVPGGKSDVWTAIRDFKVNAPAAPSVLTDAPAFKTAVV
EAGDKDISLKRIMEVHPLPPKKSLGLQIPAGASVESASVNLKTPDMKWARLYISMDGKSW
TEVPLKADGSAEIGGVIKGIRLVNAGSSPQEVTLEEFRLNLANKGGKSADSGAAGDFNLA
TFLPVELSPEKVEIPCDSPRANSAIVLSDGKEASVLACGADGRWVPVGNLAKGKKVSTFS
LKSVKKPVKALGLTGKKGNSVNIFEVIWK

Enzyme Prediction     

No EC number prediction in MGYG000002452_01385.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH84	162	451	9.4e-100	0.9932203389830508

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07555	NAGidase	1.27e-143	162	450	1	293	beta-N-acetylglucosaminidase. This family has previously been described as a hyaluronidase. However, more recently it has been shown that this family has beta-N-acetylglucosaminidase activity.
pfam02838	Glyco_hydro_20b	3.88e-17	40	155	3	123	Glycosyl hydrolase family 20, domain 2. This domain has a zincin-like fold.
pfam00754	F5_F8_type_C	2.20e-08	642	740	10	113	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
COG3525	Chb	1.11e-07	86	163	188	265	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].
cd00057	FA58C	0.006	658	714	36	92	Substituted updates: Jan 31, 2002

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWP49279.1	0.0	1	989	1	989
QWP73759.1	0.0	1	989	9	997
QHV62331.1	0.0	1	989	9	997
QHV74695.1	0.0	1	989	9	997
QUY58654.1	0.0	1	989	9	997

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2J4G_A	4.17e-143	41	714	4	670	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with n-butyl- thiazoline inhibitor [Bacteroides thetaiotaomicron VPI-5482],2J4G_B Bacteroides thetaiotaomicron GH84 O-GlcNAcase in complex with n-butyl- thiazoline inhibitor [Bacteroides thetaiotaomicron VPI-5482]
2JIW_A	4.29e-143	41	714	5	671	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with 2- Acetylamino-2-deoxy-1-epivalienamine [Bacteroides thetaiotaomicron VPI-5482],2JIW_B Bacteroides thetaiotaomicron GH84 O-GlcNAcase in complex with 2- Acetylamino-2-deoxy-1-epivalienamine [Bacteroides thetaiotaomicron VPI-5482]
2J47_A	4.29e-143	41	714	5	671	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with a imidazole-pugnac hybrid inhibitor [Bacteroides thetaiotaomicron VPI-5482],2W4X_A BtGH84 in complex with STZ [Bacteroides thetaiotaomicron VPI-5482],2W66_A BtGH84 in complex with HQ602 [Bacteroides thetaiotaomicron VPI-5482],2W66_B BtGH84 in complex with HQ602 [Bacteroides thetaiotaomicron VPI-5482],2W67_A BtGH84 in complex with FMA34 [Bacteroides thetaiotaomicron VPI-5482],2W67_B BtGH84 in complex with FMA34 [Bacteroides thetaiotaomicron VPI-5482],2WCA_A BtGH84 in complex with n-butyl pugnac [Bacteroides thetaiotaomicron VPI-5482],2XJ7_A BtGH84 in complex with 6-acetamido-6-deoxy-castanospermine [Bacteroides thetaiotaomicron VPI-5482],2XJ7_B BtGH84 in complex with 6-acetamido-6-deoxy-castanospermine [Bacteroides thetaiotaomicron VPI-5482],2XM1_A BtGH84 in complex with N-acetyl gluconolactam [Bacteroides thetaiotaomicron VPI-5482],2XM1_B BtGH84 in complex with N-acetyl gluconolactam [Bacteroides thetaiotaomicron VPI-5482],2XM2_A BtGH84 in complex with LOGNAc [Bacteroides thetaiotaomicron VPI-5482],2XM2_B BtGH84 in complex with LOGNAc [Bacteroides thetaiotaomicron VPI-5482],4UR9_A Structure of ligand bound glycosylhydrolase [Bacteroides thetaiotaomicron],4UR9_B Structure of ligand bound glycosylhydrolase [Bacteroides thetaiotaomicron],5FKY_A Structure of a hydrolase bound with an inhibitor [Bacteroides thetaiotaomicron],5FKY_B Structure of a hydrolase bound with an inhibitor [Bacteroides thetaiotaomicron],5FL0_A Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL0_B Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL1_A Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL1_B Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron]
7K41_A	4.68e-143	41	714	8	674	ChainA, O-GlcNAcase BT_4395 [Escherichia coli K-12]
5MI4_A	5.91e-143	41	714	16	682	BtGH84mutant with covalent modification by MA3 [Bacteroides thetaiotaomicron VPI-5482],5MI5_A BtGH84 mutant with covalent modification by MA3 in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482],5MI6_A BtGH84 mutant with covalent modification by MA3 in complex with Thiamet G [Bacteroides thetaiotaomicron VPI-5482],5MI7_A BtGH84 mutant with covalent modification by MA4 in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q89ZI2	4.32e-142	41	714	26	692	O-GlcNAcase BT_4395 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4395 PE=1 SV=1
Q0TR53	4.82e-82	105	548	129	574	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
Q8XL08	6.59e-82	105	548	129	574	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1
P26831	1.20e-52	41	761	41	795	Hyaluronoglucosaminidase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagH PE=1 SV=2
O60502	4.14e-34	163	421	63	331	Protein O-GlcNAcase OS=Homo sapiens OX=9606 GN=OGA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.006159	0.992526	0.000330	0.000377	0.000299	0.000255

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002452_01385.