CAZyme Information: MGYG000002452_02053

Basic Information

• Species: Akkermansia muciniphila_C
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Verrucomicrobiales; Akkermansiaceae; Akkermansia; Akkermansia muciniphila_C
• CAZyme ID: MGYG000002452_02053
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
505		57905.54	8.741

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002452	2902150	Isolate	China	Asia

• Gene Location: Start: 98949; End: 100466 Strand: +

Full Sequence      

MSLNYNFIWLLCYLLVLVGLAGYGFHRLSIVYLYWKNRNNKPQPKSHFQELPVVTVQLPM
FNEKFVVDRLLESVAALDYPQDKLEIQILDDSTDDTTEQCYRKVEELKARGFDAVCIHRT
DRTGFKAGALEAATKVAKGEFLLILDADFVPEPDLLQKTIHFFTDEGVGLVQTRWGHINR
EYNLLTRVQGMYLDGHFAMEQTARNRSGRFFTFNGTAGMWRKCVIGDAGGWSHDTLTEDM
DLSYRVQLKGWRFIYLNDVVTPAELPVDMDGFKSQQHRWTKGSIQVCQKILLDIWRSKAP
LKAKVEATTHLTCNYSYLLLALLCFLVYPICTQRIPENETVFMWFVNVALFFMTSVAVCI
FYMSAQIVVRPKSWWKELPYLPLLLTLSVGMAVNNAKAVLEAIFGHQSAFVRTPKYGVDQ
KEDRQHVSQLKRNGYKAIKSVVIPVLEIACGTFFLNLIIIMIRQGHYLSPILMIPFLGFY
YTGFCSLGRMISNLLPARQTAKAKN

Enzyme Prediction     

No EC number prediction in MGYG000002452_02053.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	54	280	1.8e-28	0.9739130434782609

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06437	CESA_CaSu_A2	7.89e-138	52	283	1	232	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.
cd06423	CESA_like	4.98e-50	56	239	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
COG1215	BcsA	1.77e-48	7	289	16	290	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06421	CESA_CelA_like	1.34e-46	52	287	1	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
cd06435	CESA_NdvC_like	5.75e-37	55	289	1	234	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWP26311.1	0.0	1	505	1	505
QHV76111.1	0.0	1	505	1	505
QWP60336.1	0.0	1	505	1	505
QUY60062.1	0.0	1	505	1	505
QWP53145.1	0.0	1	505	1	505

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LBY_A	3.39e-17	37	286	259	504	ChainA, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
5EJ1_A	3.95e-17	49	286	125	378	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	4.23e-17	49	286	137	390	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	4.24e-17	49	286	138	391	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
6YV7_B	6.21e-16	52	311	42	291	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7PC76	1.86e-62	44	315	76	349	Glucomannan 4-beta-mannosyltransferase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=CSLA1 PE=1 SV=1
Q9FNI7	2.47e-62	28	298	66	348	Glucomannan 4-beta-mannosyltransferase 2 OS=Arabidopsis thaliana OX=3702 GN=CSLA2 PE=1 SV=1
Q9SRT3	3.89e-61	49	306	218	480	Probable xyloglucan glycosyltransferase 6 OS=Arabidopsis thaliana OX=3702 GN=CSLC6 PE=1 SV=1
Q9LJP4	6.49e-61	52	423	199	565	Xyloglucan glycosyltransferase 4 OS=Arabidopsis thaliana OX=3702 GN=CSLC4 PE=1 SV=1
Q9ZQB9	9.73e-61	51	304	240	498	Probable xyloglucan glycosyltransferase 12 OS=Arabidopsis thaliana OX=3702 GN=CSLC12 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
5	27
311	330
340	362
440	462
466	488