CAZyme Information: MGYG000002452_02287

Basic Information

• Species: Akkermansia muciniphila_C
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Verrucomicrobiales; Akkermansiaceae; Akkermansia; Akkermansia muciniphila_C
• CAZyme ID: MGYG000002452_02287
• CAZy Family: GT10
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
332	MGYG000002452_3|CGC5	38824.02	8.149

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002452	2902150	Isolate	China	Asia

• Gene Location: Start: 377025; End: 378023 Strand: +

Full Sequence      

MKTLKISFLQSTPDFGREGIHQLLKDRYHVVEDDSDFDYLIATPWFYVNREAFYDFLERA
PGHITVMYACHEAIASDFMLFDYYIGLDTVPGSDRTVKLPFLRHHLQEVHGGKEGLDVRA
LLASKTGFCNFIYSNRKSHPNRDAIFHKLSAFRFVNSLGPHLNNTPGDGHRAEDWYSSSI
RMKKPYKFSIAFENAWYPGYTSEKIVTSMLAGTIPIYWGNPDIGKEFNSGAFINCHDFPT
LDDAAAYVKKVDEDDSLWCEIMSRPWKTPEQEALFLEETERETAKLYRIFDQSPEEARRK
GDGTWISYYQRFLKRGHRLRLAWRRLKKRLRK

Enzyme Prediction     

No EC number prediction in MGYG000002452_02287.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT10	108	262	2.8e-40	0.4322766570605187

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00852	Glyco_transf_10	4.30e-11	134	257	10	129	Glycosyltransferase family 10 (fucosyltransferase) C-term. This is the C-terminal domain of a family of fucosyltransferases. This enzyme transfers fucose from GDP-Fucose to GlcNAc in an alpha1,3 linkage. This family is known as glycosyltransferase family 10. The C-terminal domain is the likely binding-region for ADP (manuscript in publication).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHV76671.1	7.29e-244	1	330	1	330
QUY60626.1	7.29e-244	1	330	1	330
QHV64304.1	7.29e-244	1	330	1	330
QWP74454.1	7.29e-244	1	330	1	330
QWP49680.1	2.97e-243	1	331	1	331

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2NZW_A	4.49e-22	72	275	95	322	CrystalStructure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZW_B Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZW_C Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZX_A Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZX_B Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZX_C Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZY_A Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori],2NZY_B Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori],2NZY_C Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori]
5ZOI_A	2.10e-20	72	275	95	322	CrystalStructure of alpha1,3-Fucosyltransferase [Helicobacter pylori],5ZOI_B Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5UQ63	1.04e-23	81	265	382	566	Putative fucosyltransferase R654 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_R654 PE=3 SV=1
O30511	5.54e-21	72	275	95	322	Alpha-(1,3)-fucosyltransferase FucT OS=Helicobacter pylori OX=210 GN=fucT PE=1 SV=1
Q6NTZ6	8.81e-08	131	267	206	344	Alpha-(1,3)-fucosyltransferase 10 OS=Xenopus laevis OX=8355 GN=fut10 PE=2 SV=2
Q6A198	1.58e-07	131	255	216	344	Alpha-(1,3)-fucosyltransferase 10 OS=Bos taurus OX=9913 GN=FUT10 PE=2 SV=1
Q6A1G3	2.78e-07	131	267	208	346	Alpha-(1,3)-fucosyltransferase 10 OS=Xenopus tropicalis OX=8364 GN=fut10 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002452_02287.