CAZyme Information: MGYG000002453_00146

Basic Information

• Species: Akkermansia muciniphila_B
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Verrucomicrobiales; Akkermansiaceae; Akkermansia; Akkermansia muciniphila_B
• CAZyme ID: MGYG000002453_00146
• CAZy Family: GT4
• CAZyme Description: Glycosyltransferase Gtf1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
390	MGYG000002453_4|CGC1	45050.54	9.6608

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002453	3096868	Isolate	China	Asia

• Gene Location: Start: 130016; End: 131188 Strand: +

Full Sequence      

MNICFIAWERFGVGGVSRVLTRIMNALCREHEISVYCLRRPPLENAYGLDLENIRFFHHE
MNVYEKMRRSVMDRLVTRTPLFSSSAGARAYAFLRYTHSFKKRLTSHINRHQYDAVVFGS
GFEDSLLLALLRPQLSPRTRIISWSHAAYEDYFGFKGPHFSRYFRHALKRFYHRFDQIVV
LSDHDRRNFETRQHLATRRIYNPASFTAERHSALTSKTFVFAGSLSSHKGADLALEAFGE
FSRNNGEWNLHVYGDGPLRPWMEEFIREHGLQSRVRLHGSHTAMEREYPKHAILLFPSRC
EGFGLVQIEAMSCGLPVIAADIPICRELIRDSGAGRLFPAGDSRALCGAMHSMAGEDLAL
YARKARAQEQFFTLERIIREWNGMLKEVNP

Enzyme Prediction     

No EC number prediction in MGYG000002453_00146.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	216	353	3.6e-33	0.86875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03820	GT4_AmsD-like	3.81e-64	3	382	2	350	amylovoran biosynthesis glycosyltransferase AmsD and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. AmSD in Erwinia amylovora has been shown to be involved in the biosynthesis of amylovoran, the acidic exopolysaccharide acting as a virulence factor. This enzyme may be responsible for the formation of galactose alpha-1,6 linkages in amylovoran.
cd03811	GT4_GT28_WabH-like	6.77e-46	2	377	1	351	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
cd03801	GT4_PimA-like	1.20e-42	2	386	1	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
pfam13692	Glyco_trans_1_4	1.46e-31	217	350	2	132	Glycosyl transferases group 1.
COG0438	RfaB	3.48e-31	1	388	2	377	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUY60419.1	1.17e-292	1	390	1	390
QHV64097.1	1.17e-292	1	390	1	390
QHV76465.1	1.17e-292	1	390	1	390
QWP73109.1	1.17e-292	1	390	1	390
QWP48537.1	2.36e-292	1	390	1	390

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5D00_A	3.41e-12	250	388	234	375	Crystalstructure of BshA from B. subtilis complexed with N-acetylglucosaminyl-malate and UMP [Bacillus subtilis subsp. subtilis str. 168],5D00_B Crystal structure of BshA from B. subtilis complexed with N-acetylglucosaminyl-malate and UMP [Bacillus subtilis subsp. subtilis str. 168],5D01_A Crystal structure of BshA from B. subtilis complexed with N-acetylglucosaminyl-malate [Bacillus subtilis subsp. subtilis str. 168],5D01_B Crystal structure of BshA from B. subtilis complexed with N-acetylglucosaminyl-malate [Bacillus subtilis subsp. subtilis str. 168]
4PQG_A	4.83e-11	218	388	330	508	Crystalstructure of the pneumococcal O-GlcNAc transferase GtfA in complex with UDP and GlcNAc [Streptococcus pneumoniae TIGR4],4PQG_B Crystal structure of the pneumococcal O-GlcNAc transferase GtfA in complex with UDP and GlcNAc [Streptococcus pneumoniae TIGR4]
5N7Z_A	5.68e-11	200	341	161	309	glycosyltransferasein LPS biosynthesis [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],6Y6G_A Chain A, Lipopolysaccharide 1,6-galactosyltransferase [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5N80_A	5.70e-11	200	341	162	310	glycosyltransferaseLPS biosynthesis in complex with UDP [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
6Y6I_A	5.73e-11	200	341	163	311	ChainA, Lipopolysaccharide 1,6-galactosyltransferase [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9L1I4	2.77e-18	176	388	165	384	Exopolysaccharide phosphotransferase SCO2592 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) OX=100226 GN=SCO2592 PE=3 SV=1
O05083	8.20e-14	2	385	3	353	Uncharacterized glycosyltransferase HI_1698 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1698 PE=3 SV=1
Q65CC7	1.40e-12	165	339	144	332	Alpha-D-kanosaminyltransferase OS=Streptomyces kanamyceticus OX=1967 GN=kanE PE=1 SV=1
P42982	1.85e-11	250	388	232	373	N-acetyl-alpha-D-glucosaminyl L-malate synthase OS=Bacillus subtilis (strain 168) OX=224308 GN=bshA PE=1 SV=2
A0A0H2URG7	2.61e-10	218	388	322	500	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase GtfA subunit OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=gtfA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002453_00146.