CAZyme Information: MGYG000002453_00225

Basic Information

• Species: Akkermansia muciniphila_B
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Verrucomicrobiales; Akkermansiaceae; Akkermansia; Akkermansia muciniphila_B
• CAZyme ID: MGYG000002453_00225
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1235		131635.36	5.1835

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002453	3096868	Isolate	China	Asia

• Gene Location: Start: 225947; End: 229654 Strand: -

Full Sequence      

MKKKSLFGVLVAVALSALGNPGQGAGTVESFGVDFGNAASVAQPGWTNMGVVTTTPSSTL
KSVPLRRNNLEASSSPVLAGTLFGRSVYLAVTAKSEASVGNMCYNNANSTWREKGETRGG
QPGGVLQAESAFSFPNHGEALNTSLQLFTNGMAVRAGTVRVSLSGLAPGKEYAVSFFLGS
GKPAYQSVFLVSGAHVDVKALQTSTGSRTEDTWKGGVNTADADTYMAVEWTAAADEAGTL
VFDVVKEGSSAGTGTLNLNALTVRTDDTPAPPAPEPKPVSVLHNRALTVLSSPVALPVPA
DAWTGTGEMTCELWVRPDGDAASGAILSLGASTLSLNGGRLHLESGNAETPASVEASGQP
FAAGTWHHVAVALGTENVSLYVDGTLAGTAPAAPYLASMKNGWTGLVLAAQFKGARDELR
FWNAELGTGADDFFLTGPLPMAHPRYGRLVGLWRLDGDFRDAKWTEFADKTGSSFTRPYQ
AVTPSGTEFSIVTDNNTFRYMLVTGYVRESHIMWNWPSRPHMINNSDIIYIGAASAAANG
DISFSYPDNDVTESRGVQLLPADGARTNVLEFTGEDAYMNVGNGLLAGSNANAFTIEVNL
ALSAGEQNVTLFENDSVSMTLAWADGHYKARLQAGSTAAWEADLPAVALHEYFWLAFIRN
STAGTGVFYLNGAPLQTAAVAAGEMNGTPNAVVGRNLKGKIDDMRVWHLARPAGRLGTEV
QPNWNDRLIVAHWGNSDVFGRDTASWAEHVRTLRGMTEGVGGMRIRLGIAGGAWSAMLTN
AAARQRFADGIRELLKKYPLDGVDLDFEWLYQGDGKWTSYGQLAQAIRETNPDMFFSISL
HTVAYWFPAAYMQYVDYFTFQNYGPAIDVNTYNSMVSACGKFRNQGFPDKKIILSAPFQG
TPGTSGLPEGKKPGDYIKGYRDIAANCPETDNPDNDTAVYSYSGLNLTLHYNGVTTVRKK
AKYISDQKLAGFMYWDMGLDAADAAGSNNYFDRRSLLRAANRYVSSTSFPMTASPFGLSR
VGVSVPAAGGAVDVEIQMEEEALGWVVADSPEWISVSAASGIGRTTVILTASENKSAAGR
SGVVVFRASDKQECAVTVTQAGAGLAGYDKWVQDTFPPDATADRTAADASPAGDGVTNLM
KYATGLDPLKPCGSVTKVSVEEGVEGSRHLVLRWPVNPQAAEVKHEVEVSPDLVNWTSLG
EVETAGKTSAEFRDAEPVQDSAMKRRFLRLKVTRE

Enzyme Prediction     

No EC number prediction in MGYG000002453_00225.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	763	990	8.2e-33	0.7837837837837838

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00704	Glyco_hydro_18	1.93e-25	762	980	63	307	Glycosyl hydrolases family 18.
smart00636	Glyco_18	7.22e-25	771	980	79	334	Glyco_18 domain.
cd06548	GH18_chitinase	3.14e-14	765	980	85	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
cd14948	BACON	9.31e-14	1016	1101	2	83	Bacteroidetes-Associated Carbohydrate-binding (putative) Often N-terminal (BACON) domain. The BACON domain is found in diverse domain architectures and accociated with a wide variety of domains, including carbohydrate-active enzymes and proteases. It was named for its suggested function of carbohydrate binding; the latter was inferred from domain architectures, sequence conservation, and phyletic distribution. However, recent experimental data suggest that its primary function in Bacteroides ovatus endo-xyloglucanase BoGH5A is to distance the catalytic module from the cell surface and confer additional mobility to the catalytic domain for attack of the polysaccharide. No evidence for a direct role in carbohydrate binding could be found in that case. The large majority of BACON domains are found in Bacteroidetes.
pfam13385	Laminin_G_3	4.66e-13	305	426	15	145	Concanavalin A-like lectin/glucanases superfamily. This domain belongs to the Concanavalin A-like lectin/glucanases superfamily.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWP63366.1	0.0	1	1235	1	1235
QWP02953.1	0.0	1	1235	1	1235
QWP21628.1	0.0	1	1235	1	1235
QWP26769.1	0.0	1	1235	1	1235
QWP60832.1	0.0	1	1235	1	1235

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5GZU_A	1.30e-06	772	993	117	390	CrystalStructure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZU_B Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZV_A Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZV_B Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7]
5GZT_B	1.39e-06	772	993	368	641	CrystalStructure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7]
1ITX_A	3.37e-06	747	980	107	406	ChainA, Glycosyl Hydrolase [Niallia circulans]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000954	0.694904	0.303360	0.000259	0.000273	0.000229

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002453_00225.