CAZyme Information: MGYG000002453_00305

Basic Information

• Species: Akkermansia muciniphila_B
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Verrucomicrobiales; Akkermansiaceae; Akkermansia; Akkermansia muciniphila_B
• CAZyme ID: MGYG000002453_00305
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1045	MGYG000002453_5|CGC1	110112.71	4.871

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002453	3096868	Isolate	China	Asia

• Gene Location: Start: 70775; End: 73912 Strand: -

Full Sequence      

MNAFQTIRRTVSSSAVLFLLLLGTALARGAEEAASENFDSFPTGSFTSLETALGTMTAES
GHAAIASNRCSSQPNCMRLIGLGAGTKSTATLMLPAPLAVKKTLALTGERWTSDSPFSFT
IHAADGEGNETLVADGSSLKTGSNPMTQQVRGAIPSGTARLIFRCEAPANKGVLFDDLVF
SEFNPLSSTAEAWPAMIRMEANGILRFSLTELPAAYDGIAVTVDMSPSDDLGDIESVSLY
TGDADGIYSAPAYGSSGHGAMSTTGVLASPAQPPAPVMTFPVTPGVLTNGRQYYFWVSVK
LKNSASMDHKVGARITSVTVDGQTTDVADGVTARQRIGYAVAKANDPVYGGPLEGKASRK
FRIPGIVRARNGDLVSVFDIRYDGRNDMQANIDTGCSRSTDNGRTWTPVNVAVNFNPTGD
SANDYHSGYGVSDPCILLDEVNGTLWVAGIARHGLASSKANVDVESLETAQYVVAYSTDN
GRTWGSADPGTGEFVKMKPRSINKDIKNRAWKSFFQGPGHGITMKKTVNGVRPIVFPSQI
WTGASGAGTPQSCIIYSLDRGQTWISEDIGKSGTPGIGAGSSECAVTELSDGRLMLNARN
ESRSGYRKVFTTDDMGKTWTAHATNLKALPEPAACQASQLAVENSANISRALLFSNPDKT
SAPRARMTLKASFDEGATWPSSRQVLYDSRPCCGYSDICETGDGHIGVLYEGLNGDENIF
FLRIPYDEFLPSLDVPAAGAPVRVGPEGVTAATFTVSSDDSWTASSSAGWITVSPSSGSG
NGSVTYSVDRWEGAGERTGTITVAVPGVQPVSVTVIQSGRAPALAVSPAALVLPKNGGTA
VFSVTCDAAWNVSKTADWINITGMQGAETGNGTVSIAAEANAAEGSRTAQLSFSSFGTVR
SATVTQRGQKRTWNEWKEDEITSRDPDTDQTGPNDSPAGDGIPNLLKYATGLDPLKPCGS
VVQVTAEEAGGDACLVLGWPVNPEATGIRHAVEASEDLQTWTETAEVETEGKSSATFRDA
VPMNAESPRRRFLRLKISREGESPL

Enzyme Prediction     

No EC number prediction in MGYG000002453_00305.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	356	725	4.2e-79	0.9532163742690059

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	2.99e-82	347	725	2	339	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
cd14948	BACON	2.70e-16	823	906	1	82	Bacteroidetes-Associated Carbohydrate-binding (putative) Often N-terminal (BACON) domain. The BACON domain is found in diverse domain architectures and accociated with a wide variety of domains, including carbohydrate-active enzymes and proteases. It was named for its suggested function of carbohydrate binding; the latter was inferred from domain architectures, sequence conservation, and phyletic distribution. However, recent experimental data suggest that its primary function in Bacteroides ovatus endo-xyloglucanase BoGH5A is to distance the catalytic module from the cell surface and confer additional mobility to the catalytic domain for attack of the polysaccharide. No evidence for a direct role in carbohydrate binding could be found in that case. The large majority of BACON domains are found in Bacteroidetes.
pfam13088	BNR_2	8.76e-16	397	708	23	280	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
pfam14873	BNR_assoc_N	2.59e-15	190	324	8	149	N-terminal domain of BNR-repeat neuraminidase. This domain is usually found at the N-terminus of the BNR-repeat neuraminidase protein family.
pfam13859	BNR_3	3.44e-15	363	620	1	212	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWP54611.1	0.0	1	1045	1	1045
QWP27708.1	0.0	1	1045	1	1045
QWP61791.1	0.0	1	1045	1	1045
QWP69127.1	0.0	1	1045	1	1045
QWP03917.1	0.0	1	1045	1	1045

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MNJ_A	2.39e-70	209	711	44	521	Hadzamicrobial sialidase Hz136 [Alistipes],6MNJ_B Hadza microbial sialidase Hz136 [Alistipes]
6MYV_A	4.88e-70	294	711	121	504	Sialidase26co-crystallized with DANA-Gc [bacterium],6MYV_B Sialidase26 co-crystallized with DANA-Gc [bacterium],6MYV_C Sialidase26 co-crystallized with DANA-Gc [bacterium],6MYV_D Sialidase26 co-crystallized with DANA-Gc [bacterium]
6MRV_A	9.28e-70	294	711	142	525	Sialidase26co-crystallized with DANA [bacterium],6MRV_B Sialidase26 co-crystallized with DANA [bacterium],6MRX_A Sialidase26 apo [bacterium],6MRX_B Sialidase26 apo [bacterium],6MRX_C Sialidase26 apo [bacterium],6MRX_D Sialidase26 apo [bacterium]
4FJ6_A	1.65e-66	294	711	122	504	Crystalstructure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503],4FJ6_B Crystal structure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503],4FJ6_C Crystal structure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503],4FJ6_D Crystal structure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503]
4Q6K_A	5.88e-63	294	711	124	507	Crystalstructure of a putative neuraminidase (BACCAC_01090) from Bacteroides caccae ATCC 43185 at 1.90 A resolution (PSI Community Target) [Bacteroides caccae ATCC 43185],4Q6K_B Crystal structure of a putative neuraminidase (BACCAC_01090) from Bacteroides caccae ATCC 43185 at 1.90 A resolution (PSI Community Target) [Bacteroides caccae ATCC 43185],4Q6K_C Crystal structure of a putative neuraminidase (BACCAC_01090) from Bacteroides caccae ATCC 43185 at 1.90 A resolution (PSI Community Target) [Bacteroides caccae ATCC 43185],4Q6K_D Crystal structure of a putative neuraminidase (BACCAC_01090) from Bacteroides caccae ATCC 43185 at 1.90 A resolution (PSI Community Target) [Bacteroides caccae ATCC 43185]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P31206	1.64e-66	194	711	34	526	Sialidase OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=nanH PE=3 SV=2
Q02834	6.99e-31	327	711	29	386	Sialidase OS=Micromonospora viridifaciens OX=1881 GN=nedA PE=1 SV=1
P10481	1.17e-19	358	716	33	366	Sialidase OS=Clostridium perfringens OX=1502 GN=nanH PE=1 SV=1
P15698	2.72e-19	361	716	54	384	Sialidase OS=Paeniclostridium sordellii OX=1505 PE=1 SV=1
P29768	9.58e-10	351	620	26	264	Sialidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=nanH PE=1 SV=4

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001907	0.997322	0.000238	0.000204	0.000152	0.000155

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002453_00305.