CAZyme Information: MGYG000002453_00520

Basic Information

• Species: Akkermansia muciniphila_B
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Verrucomicrobiales; Akkermansiaceae; Akkermansia; Akkermansia muciniphila_B
• CAZyme ID: MGYG000002453_00520
• CAZy Family: GH109
• CAZyme Description: Inositol 2-dehydrogenase/D-chiro-inositol 3-dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
401	MGYG000002453_10|CGC4	44763.96	7.4818

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002453	3096868	Isolate	China	Asia

• Gene Location: Start: 131097; End: 132302 Strand: +

Full Sequence      

MPYLNAAEALTDARPLKVGLVGCGGRGLGAMKNALDADPGTVVWALADVFRERIDFGSNL
LTEQYGSRVQLDKSRLFDGLDGYKKLLQTDIDVVLLCTPPAFRPEHLAAAIDAGKHIYAE
KPVAVDVPGVLSVLESARLAKLKNLVILDGFCWRYDKANEEAHRKLSSGELGRVLSFDGL
YYTTPPKSPLALDSRPSSDTDVAWALRNWTAWNWLSGGQFVEQIVHTIDGMVWSMNEQLP
LAAFGSGGRAQRRDDGDVWDHYDVYFEYDHNVAAHISCRQWVGCHGEIVDRTVCEKGMLV
TPYRPHIQADKRWRFRGERGNMYADTHVAFYRFLRSGTWKQTLESAANKTLVAIMGREAA
HTGQRITWEQIKKSATRLVPEDLTMDTPLPPARIPRPGRAA

Enzyme Prediction     

No EC number prediction in MGYG000002453_00520.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	16	181	2.4e-17	0.39598997493734334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	4.65e-33	14	333	2	296	Predicted dehydrogenase [General function prediction only].
TIGR04380	myo_inos_iolG	5.26e-15	15	229	1	179	inositol 2-dehydrogenase. All members of the seed alignment for this model are known or predicted inositol 2-dehydrogenase sequences co-clustered with other enzymes for catabolism of myo-inositol or closely related compounds. Inositol 2-dehydrogenase catalyzes the first step in inositol catabolism. Members of this family may vary somewhat in their ranges of acceptable substrates and some may act on analogs to myo-inositol rather than myo-inositol per se. [Energy metabolism, Sugars]
pfam01408	GFO_IDH_MocA	7.99e-11	16	147	1	117	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWP59694.1	5.29e-306	1	401	1	401
QWP01848.1	5.29e-306	1	401	1	401
QWP52505.1	5.29e-306	1	401	1	401
QWP62244.1	5.29e-306	1	401	1	401
QWP67019.1	5.29e-306	1	401	1	401

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3RC7_A	1.68e-13	8	187	20	182	CrystalStructure of the Y186F mutant of KijD10, a 3-ketoreductase from Actinomadura kijaniata in complex with TDP-benzene and NADP [Actinomadura kijaniata]
3RBV_A	1.68e-13	8	187	20	182	CrystalStructure of KijD10, a 3-ketoreductase from Actinomadura kijaniata incomplex with NADP [Actinomadura kijaniata],3RC1_A Crystal Structure of KijD10, a 3-ketoreductase from Actinomadura kijaniata incomplex with NADP and TDP-benzene [Actinomadura kijaniata],3RC2_A Crystal Structure of KijD10, a 3-ketoreductase from Actinomadura kijaniata in complex with TDP-benzene and NADP; open conformation [Actinomadura kijaniata]
3RCB_A	5.43e-13	8	187	20	182	Crystalstructure of the K102E mutant of KijD10, a 3-ketoreductase from Actinomadura kijaniata in complex with TDP-benzene and NADP [Actinomadura kijaniata]
3RC9_A	9.76e-13	8	187	20	182	CrystalStructure of the K102A mutant of KijD10, a 3-ketoreductase from Actinomadura kijaniata in complex with TDP-benzene and NADP [Actinomadura kijaniata]
3CEA_A	2.37e-11	10	245	3	207	ChainA, Myo-inositol 2-dehydrogenase [Lactiplantibacillus plantarum WCFS1],3CEA_B Chain B, Myo-inositol 2-dehydrogenase [Lactiplantibacillus plantarum WCFS1],3CEA_C Chain C, Myo-inositol 2-dehydrogenase [Lactiplantibacillus plantarum WCFS1],3CEA_D Chain D, Myo-inositol 2-dehydrogenase [Lactiplantibacillus plantarum WCFS1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B3TMR8	8.06e-13	8	187	2	164	dTDP-3,4-didehydro-2,6-dideoxy-alpha-D-glucose 3-reductase OS=Actinomadura kijaniata OX=46161 GN=KijD10 PE=1 SV=1
A9N564	4.00e-09	16	237	3	187	Inositol 2-dehydrogenase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) OX=1016998 GN=iolG PE=3 SV=1
Q8ZK57	4.00e-09	16	237	3	187	Inositol 2-dehydrogenase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=iolG PE=1 SV=1
B5F3F4	4.00e-09	16	237	3	187	Inositol 2-dehydrogenase OS=Salmonella agona (strain SL483) OX=454166 GN=iolG PE=3 SV=1
Q9ZA33	7.36e-09	4	201	1	178	dTDP-3,4-didehydro-2,6-dideoxy-alpha-D-glucose 3-reductase OS=Streptomyces violaceoruber OX=1935 GN=gra-orf26 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000019	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002453_00520.