CAZyme Information: MGYG000002453_00783

Basic Information

• Species: Akkermansia muciniphila_B
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Verrucomicrobiales; Akkermansiaceae; Akkermansia; Akkermansia muciniphila_B
• CAZyme ID: MGYG000002453_00783
• CAZy Family: GT8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
362	MGYG000002453_10|CGC8	41917.46	8.5928

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002453	3096868	Isolate	China	Asia

• Gene Location: Start: 430460; End: 431548 Strand: +

Full Sequence      

MPTISPLSGMAEPPVSVMFAVTSSWLIPLAVAIRSLCVHSDPRRNYELHIVHHGLEEEQM
KELGKAVSGYPRVSLGFCRLPERLLRILQHRDCGRFSPLTYGRLLAAALFPRHDRVVYLD
VDVLLNGDVAELYDADLHGAPIGAVRDCAVLQSISTGRLPDHLEYISGMGVTNPRLYCNT
GVMVMDLVQMREQETEDRLLRLLEAHPDSFPYVDQDIINIVFHGRIAPLPLRWNYHFQFE
LHHAGMADLISGTEFEEAPALFESRSWKLFHLVGDYKPWLPPDMEKIYHRLYLALWWPLA
RQTPAFRRELRALYRQFTRAFRSRLRHHQWSLPVSPGRNFRKRREKIKTLQRQLAVFDGS
WP

Enzyme Prediction     

No EC number prediction in MGYG000002453_00783.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	14	280	8.9e-52	0.8754863813229572

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04194	GT8_A4GalT_like	7.38e-60	15	279	1	246	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
COG1442	RfaJ	2.11e-41	16	329	4	289	Lipopolysaccharide biosynthesis protein, LPS:glycosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01501	Glyco_transf_8	2.26e-35	19	280	4	249	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
cd00505	Glyco_transf_8	3.39e-17	96	279	79	244	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
cd06429	GT8_like_1	4.26e-14	43	280	49	241	GT8_like_1 represents a subfamily of GT8 with unknown function. A subfamily of glycosyltransferase family 8 with unknown function: Glycosyltransferase family 8 comprises enzymes with a number of known activities; lipopolysaccharide galactosyltransferase lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase and inositol 1-alpha-galactosyltransferase. It is classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QAT91239.1	2.46e-273	1	362	1	362
QWP37660.1	2.46e-273	1	362	1	362
QWP40107.1	2.46e-273	1	362	1	362
QWP35219.1	2.46e-273	1	362	1	362
QWP42560.1	2.46e-273	1	362	1	362

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6U4B_A	5.95e-27	7	287	294	573	ChainA, WbbM protein [Klebsiella pneumoniae]
1SS9_A	1.11e-11	97	279	80	252	ChainA, alpha-1,4-galactosyl transferase [Neisseria meningitidis]
1G9R_A	8.77e-11	97	235	80	209	ChainA, GLYCOSYL TRANSFERASE [Neisseria meningitidis],1GA8_A Chain A, GALACTOSYL TRANSFERASE LGTC [Neisseria meningitidis]
5GVW_A	1.78e-08	16	279	7	235	Crystalstructure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVW_B Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVW_C Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVW_D Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae]
5GVV_A	2.33e-07	16	279	7	235	Crystalstructure of the glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVV_F Crystal structure of the glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P25148	1.04e-14	35	296	27	276	General stress protein A OS=Bacillus subtilis (strain 168) OX=224308 GN=gspA PE=1 SV=2
A0A0H2URH2	1.06e-14	16	297	4	242	Glycosyltransferase GlyF OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyF PE=3 SV=1
P27129	2.60e-13	96	279	105	272	Lipopolysaccharide 1,2-glucosyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=rfaJ PE=3 SV=2
O04253	7.19e-12	32	286	83	328	Probable galacturonosyltransferase-like 6 OS=Arabidopsis thaliana OX=3702 GN=GATL6 PE=2 SV=1
Q0V7R1	1.29e-11	97	286	142	322	Probable galacturonosyltransferase-like 3 OS=Arabidopsis thaliana OX=3702 GN=GATL3 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999946	0.000089	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002453_00783.