CAZyme Information: MGYG000002453_01442

Basic Information

• Species: Akkermansia muciniphila_B
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Verrucomicrobiales; Akkermansiaceae; Akkermansia; Akkermansia muciniphila_B
• CAZyme ID: MGYG000002453_01442
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
385	MGYG000002453_14|CGC2	42968.54	7.1409

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002453	3096868	Isolate	China	Asia

• Gene Location: Start: 74207; End: 75364 Strand: -

Full Sequence      

MELGGAERALLGLLDALDASRFRVDLFVYRHSGELMPLIPDKVNLLPELPSYRALSRPVK
DILKEGRLGIAGARLWAKWSSARFGRRLDGPENYAVFDDAAAAVSPFLPSLKKLGVYDLA
ISFLTPHRIVRDKVRARRKIAWIHTDYSSIGINVERELPVWRGYDHIISISPQAGKGFLS
RFPELEDRLVQMENIVSPEVVREQAALEDVSGVMGGSPCLCTVGRFSHAKGMDRAVRLAA
RLVGLGMEQLRWHLIGYGDEAALRREIRDCGMEEHVIILGKKANPYPYMAACDLYVQPSR
YEGKAVAVREAQILGRPVAVTRFPTSAGHLEDGVDGMIIPNEEEGAALELFRLLNDAGRL
ESLSAECRRRDYGNRDEILKLEELI

Enzyme Prediction     

No EC number prediction in MGYG000002453_01442.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	217	357	1.2e-20	0.89375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03811	GT4_GT28_WabH-like	6.91e-51	1	369	9	340	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
cd03820	GT4_AmsD-like	1.70e-21	117	366	88	332	amylovoran biosynthesis glycosyltransferase AmsD and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. AmSD in Erwinia amylovora has been shown to be involved in the biosynthesis of amylovoran, the acidic exopolysaccharide acting as a virulence factor. This enzyme may be responsible for the formation of galactose alpha-1,6 linkages in amylovoran.
cd03801	GT4_PimA-like	5.27e-21	114	370	80	347	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
pfam13692	Glyco_trans_1_4	5.03e-19	220	356	4	138	Glycosyl transferases group 1.
COG0438	RfaB	2.01e-18	220	370	202	356	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWP59891.1	5.69e-252	1	385	11	395
QWP47787.1	5.69e-252	1	385	11	395
QWP20684.1	5.69e-252	1	385	11	395
QWP02048.1	5.69e-252	1	385	11	395
QWP67266.1	5.69e-252	1	385	11	395

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000084	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002453_01442.