CAZyme Information: MGYG000002453_01906

Basic Information

• Species: Akkermansia muciniphila_B
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Verrucomicrobiales; Akkermansiaceae; Akkermansia; Akkermansia muciniphila_B
• CAZyme ID: MGYG000002453_01906
• CAZy Family: GT10
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
332	MGYG000002453_15|CGC4	38711.9	7.8285

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002453	3096868	Isolate	China	Asia

• Gene Location: Start: 297424; End: 298422 Strand: +

Full Sequence      

MKTLKISFLQSTPDFGREGIYQLLKDRYRVVEDDSDFDYLIATPWFYVNREAFYDFLERA
PGHITVMYGCHEAIAPDFMLFDYYIGLDAVPGSDRTVKLPFLRHHLQEVHGGKEGLDVRA
LLASKTGFCNFIYANRKSHPNRDAIFHKLSAVRFVNSLGPHLNNTPGDGHRSEDWYASSI
RMKKPYKFSIAFENAWYPGYTSEKIVTSMLAGTIPIYWGNPDIGREFNSAAFINCHDFPT
LDDAAAYVKKVDEDDGLWCEIMSRPWKTPEQEALFLEETERETAKLYRIFDQSPEEARRK
GDGTWIAYYQRFLKRGHRLRLAWRRLKNRLSR

Enzyme Prediction     

No EC number prediction in MGYG000002453_01906.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT10	108	262	2e-38	0.4322766570605187

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00852	Glyco_transf_10	6.71e-11	152	255	19	127	Glycosyltransferase family 10 (fucosyltransferase) C-term. This is the C-terminal domain of a family of fucosyltransferases. This enzyme transfers fucose from GDP-Fucose to GlcNAc in an alpha1,3 linkage. This family is known as glycosyltransferase family 10. The C-terminal domain is the likely binding-region for ADP (manuscript in publication).
pfam18025	FucT_N	0.002	14	101	11	88	Alpha-(1,3)-fucosyltransferase FucT N-terminal domain. This is the N-terminal domain of the alpha chain found in Helicobacter pylori Fucosyltransferase protein which is involved in the production of Lewis x trisaccharide, a major component of lipopolysaccharide. The N-terminal domain contains the catalyst base, Glu-95 which is equivalent to the Asp-100 of other members of the glycosyltransferases-B family. The domain contains the pocket where LacNAc binds. The domain is composed of 2-10 heptad repeats and a conserved N-terminal alpha-beta-alpha motif which has little sequence similarity to the conserved N-terminal motif in other glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHV76671.1	2.20e-254	1	332	1	332
QUY60626.1	2.20e-254	1	332	1	332
QHV64304.1	2.20e-254	1	332	1	332
QWP74454.1	2.20e-254	1	332	1	332
QWP49680.1	1.81e-253	1	330	1	330

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2NZW_A	1.09e-24	10	275	37	322	CrystalStructure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZW_B Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZW_C Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZX_A Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZX_B Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZX_C Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZY_A Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori],2NZY_B Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori],2NZY_C Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori]
5ZOI_A	1.50e-22	10	275	37	322	CrystalStructure of alpha1,3-Fucosyltransferase [Helicobacter pylori],5ZOI_B Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O30511	1.62e-23	10	275	37	322	Alpha-(1,3)-fucosyltransferase FucT OS=Helicobacter pylori OX=210 GN=fucT PE=1 SV=1
Q5UQ63	1.17e-22	81	265	382	566	Putative fucosyltransferase R654 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_R654 PE=3 SV=1
Q5F2L1	2.12e-07	141	258	226	347	Alpha-(1,3)-fucosyltransferase 10 OS=Rattus norvegicus OX=10116 GN=Fut10 PE=2 SV=1
Q5F2L2	2.82e-07	141	258	226	347	Alpha-(1,3)-fucosyltransferase 10 OS=Mus musculus OX=10090 GN=Fut10 PE=2 SV=1
Q6NTZ6	4.92e-07	141	267	216	344	Alpha-(1,3)-fucosyltransferase 10 OS=Xenopus laevis OX=8355 GN=fut10 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000080	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002453_01906.