CAZyme Information: MGYG000002453_02325

Basic Information

• Species: Akkermansia muciniphila_B
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Verrucomicrobiales; Akkermansiaceae; Akkermansia; Akkermansia muciniphila_B
• CAZyme ID: MGYG000002453_02325
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
372		41984.51	8.0115

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002453	3096868	Isolate	China	Asia

• Gene Location: Start: 813505; End: 814623 Strand: +

Full Sequence      

MKLYMIAGEKSGDIHGALLLKNLLRLMPGMEVRGLGGHGMHALCPGVEDWADEAAVIGVV
EVLKKYGWFRKRFLSILERIRQDQPDCLILIDYPGFNLRLAEKVRKCCPHTKIIYFISPQ
VWAWHRGRIPKMVRMLDLMMCIFPFEAPLFQEAGLKTEFVGHPLVDEIASIRKDDVREAS
LVGLFPGSRNREIDRHFPVLIEVVRRLSGERPELSFETAASTEALAERMRGMAQKAGMPP
ELFHITVGGYHELMDRAAVGVVASGTATMEAALHRLPYMLVYKVPLLTYWMARMLIKIRF
IGMVNILAQKSVVKELIQFDFTPDQVIEEIERLLVPENRDALLADMKQASDKLGQGGAAE
HAAQAVCRLLKE

Enzyme Prediction     

No EC number prediction in MGYG000002453_02325.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	353	4.7e-104	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	2.39e-112	1	371	2	376	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	3.83e-103	1	372	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.86e-78	3	366	1	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	2.25e-65	5	366	10	382	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.77e-61	52	372	46	346	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWP50112.1	1.27e-271	1	372	1	372
QWP69500.1	2.99e-270	1	372	1	372
QWP04273.1	2.99e-270	1	372	1	372
QWP64696.1	2.99e-270	1	372	1	372
QWP28066.1	2.99e-270	1	372	1	372

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	2.02e-42	5	369	11	380	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	2.02e-42	5	369	11	380	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q74AT9	1.38e-74	2	370	8	380	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
Q1D393	3.76e-74	2	370	6	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
B3E4H8	1.06e-73	2	372	8	382	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q39T49	4.30e-73	2	370	8	380	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q2LVL8	5.15e-71	5	372	8	380	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002453_02325.