CAZyme Information: MGYG000002454_00040

Basic Information

• Species: Akkermansia muciniphila
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Verrucomicrobiales; Akkermansiaceae; Akkermansia; Akkermansia muciniphila
• CAZyme ID: MGYG000002454_00040
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
608		67507.53	9.7726

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002454	2762447	Isolate	China	Asia

• Gene Location: Start: 48906; End: 50732 Strand: +

Full Sequence      

MVLTCKHHDDFCLWPTKTTRHSVAASPWKQGKGDVVKEVSRACGKYGVRFGVYLSPWDRN
AASYGTPDYIRMYRRQLKELATGYGPIFLAWFDGANGGDGYYGGAREKRSIDRSTYYDWK
TTWGELKKRQPGAVIFSDVGPDVRWVGNESGYAGYPCWATYTPVPLQAGTEPAPGAVRYR
LGTEGTMDGKYWIPAEVDVSIRPGWFWHEHENSRVRTPENLLKLYFDSVGRGANLNLNVP
PDRRGRIHEEDKKSLAGFRVLLDELYSRNFASGAQVESSSSRKGHGAEQVLDRKRTTYWV
AAPEDKHPCVVLKLPKPAAFDVIRLAEPIQLGQRVRKFRVEVRENGQWSRWAEGVSIGAR
VLLKGRPVTADGVRVVLEQSRAVPALCEVSLWKYPVILNAPAVSYDRNGRVTLASAENVV
IRYTTDGTEPGPQSAVYRNPFLLPAGGTVKAAAEYRGRKSSVTTQLIPVPTRDWKVVSGE
RSAAAPELAIDGDSSTLWHTHAAQGELAPPQALEIDMGRPVNVASVIYTPRRDSATGTID
RYAVYLSADGNTWGAPVAEGEFSNIRANPVPQRIDLKVPVKVRYLRFVGKRVVEGSHVAV
AELRVLEK

Enzyme Prediction     

EC	3.2.1.111	3.2.1.51

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	1	259	1e-60	0.6271676300578035
CBM32	482	603	9.1e-21	0.8629032258064516

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3669	AfuC	1.50e-42	1	391	71	429	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
pfam01120	Alpha_L_fucos	5.80e-30	1	257	101	323	Alpha-L-fucosidase.
smart00812	Alpha_L_fucos	6.99e-24	1	258	98	326	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
pfam00754	F5_F8_type_C	3.04e-19	485	603	13	127	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
cd00057	FA58C	6.21e-14	478	588	18	127	Substituted updates: Jan 31, 2002

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QAA66362.1	0.0	1	608	1	608
QHV25510.1	0.0	1	608	1	608
QAA68614.1	0.0	1	608	1	608
QHV48588.1	0.0	1	608	1	608
QAA64101.1	0.0	1	608	1	608

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5K9H_A	2.12e-95	1	605	99	583	Crystalstructure of a glycoside hydrolase 29 family member from an unknown rumen bacterium [unidentified]
4ZRX_A	1.31e-85	1	586	92	562	Crystalstructure of a putative alpha-L-fucosidase (BACOVA_04357) from Bacteroides ovatus ATCC 8483 at 1.59 A resolution [Bacteroides ovatus ATCC 8483]
3UES_A	7.70e-82	1	386	79	470	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UES_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
3MO4_A	8.13e-82	1	386	81	472	Thecrystal structure of an alpha-(1-3,4)-fucosidase from Bifidobacterium longum subsp. infantis ATCC 15697 [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3MO4_B The crystal structure of an alpha-(1-3,4)-fucosidase from Bifidobacterium longum subsp. infantis ATCC 15697 [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
3EYP_A	1.66e-81	2	393	72	455	Crystalstructure of putative alpha-L-fucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],3EYP_B Crystal structure of putative alpha-L-fucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],4OUE_A Crystal structure of an a-L-Fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with IPTG [Bacteroides thetaiotaomicron VPI-5482],4OUE_B Crystal structure of an a-L-Fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with IPTG [Bacteroides thetaiotaomicron VPI-5482],4OZO_A Crystal structure of an a-L-fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with oNPTG [Bacteroides thetaiotaomicron VPI-5482],4OZO_B Crystal structure of an a-L-fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with oNPTG [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7XUR3	4.68e-85	1	386	100	470	Putative alpha-L-fucosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0560400 PE=3 SV=2
Q8GW72	1.89e-84	1	392	98	477	Alpha-L-fucosidase 1 OS=Arabidopsis thaliana OX=3702 GN=FUC1 PE=1 SV=2
I1S2N3	9.96e-12	469	607	50	188	Galactose oxidase OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GAOA PE=3 SV=1
P0CS93	1.31e-11	469	607	50	188	Galactose oxidase OS=Gibberella zeae OX=5518 GN=GAOA PE=1 SV=1
P29767	2.71e-08	458	607	42	185	Sialidase OS=Clostridium septicum OX=1504 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002454_00040.