CAZyme Information: MGYG000002454_00064

Basic Information

• Species: Akkermansia muciniphila
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Verrucomicrobiales; Akkermansiaceae; Akkermansia; Akkermansia muciniphila
• CAZyme ID: MGYG000002454_00064
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
744		82825.6	7.3422

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002454	2762447	Isolate	China	Asia

• Gene Location: Start: 81365; End: 83599 Strand: +

Full Sequence      

MRFFAFSKNGWKKYFLLPVLAVFSAGTPVSGASADWNEKTIRDNLQLVAEWQAKHPKRRS
PLHWTYGAFYSGLAQYGLSVPEGPGLPLLRKAGEEQEWNILNRHYHADDHAVGHAWMEMA
MEDGNPSAASKIRAVLDKVMNRPSSASLQFLTPGCQDRWSWSDALFMSPPVFVKLAAYTG
DRRYLEFMDREYKLTCDYLFDREEGLFFRDSRYFTVPAANGKKMFWSRGNGWVIAGLPLI
LQDMPADWPSRPFYEDLLKRLAAALKKCQSPDGSWHASLLDPDDPPLKEMSGTLFIMYGM
LWGVNQGYLDADEYLPSIRKAWKAACDAVSKEGALGWVQPIADKPGHYSGKDTEVYGAGA
YLLAGSELRKYVIGRDHPRKKTVTVTNPLGRFRPAETVSVPWPSGGSGDGAGLRVFDVRH
GRVIPHQLADTDGDGTADTLLFQSNFRPGTVRDFWILEDSSLDAAPSADVCFSRPVPERL
DDFAWENDLTAHRIYGPAVARPAPEGEGLVSSGTDVWSKRAGVPVINEFYKRGDYHRDHG
RGLDMYNVGPGRGCGGIAVFRDGKPHVSGNWAGARTLYNGPVQTAFEVVYAPWDIGGGVR
VAETRRVTLDAGSRFSKIRSVLNIRGAETVQAGVGMDAGKRRNDYEAVMEDRESGGLMTA
WSRPRREDGCLGAAVIVPWVPEGRAVDAEDCTYWLRRVVNGEPFEWYMGAVWDRASPIQS
AAGWEAEARRVRECIGHPLQVRVR

Enzyme Prediction     

No EC number prediction in MGYG000002454_00064.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	58	369	1e-80	0.9698795180722891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	2.36e-72	62	371	27	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
pfam16153	DUF4861	7.04e-63	385	741	1	382	Domain of unknown function (DUF4861). This family consists of uncharacterized proteins around 400 residues in length and is mainly found in various Bacteroides species. The function of this family is unknown. However, in many instances the domain lies upstream of a glycosyl hydrolase family, usually family 88, so it might be involved in carbohydrate binding.
COG4225	YesR	1.17e-45	63	368	35	353	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHV23291.1	0.0	1	744	1	744
QHV27773.1	0.0	1	744	1	744
QHV48611.1	0.0	1	744	1	744
QAA38687.1	0.0	1	744	1	744
QAA64124.1	0.0	1	744	1	744

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CE7_A	2.35e-65	36	370	24	368	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
5NOA_A	5.19e-49	22	372	8	375	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	1.83e-43	157	372	137	358	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WF04	1.31e-74	17	368	48	408	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
T2KPL9	1.07e-68	8	370	2	374	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
L7P9J4	1.57e-64	36	370	31	375	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
T2KN67	1.64e-45	361	743	8	394	Uncharacterized protein P7 OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21960 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.033299	0.964375	0.001290	0.000385	0.000309	0.000299

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002454_00064.