CAZyme Information: MGYG000002454_01329

Basic Information

• Species: Akkermansia muciniphila
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Verrucomicrobiales; Akkermansiaceae; Akkermansia; Akkermansia muciniphila
• CAZyme ID: MGYG000002454_01329
• CAZy Family: GT101
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
296	MGYG000002454_1|CGC21	33899.08	8.7005

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002454	2762447	Isolate	China	Asia

• Gene Location: Start: 1591745; End: 1592635 Strand: +

Full Sequence      

MKKILLCFFIQLRGVFLKISYLCGHHPKVLSIKDSLSYILKHRISISRYGDGEILLMEGY
PIGFQKEDAALATRLREIARNPIPQHRVCIPDVFSGISSYNKESRKFWKDFLFRGNGLTL
FNKYFQSGPYLNTQISRFYEHLKDKTETPQYISLWRQIFHNRHLILVEGTGSKLGFHNDL
FEGAASIRRIVCPAENAFNYYHAILETTLDKAKGMDLLVLIALGPTATVLAHDLAEHGVQ
SIDVGHIDIEYEWFQMKATSKVPVPWRYVNETGNRLSELSSDPEYTSQIIAQIGLS

Enzyme Prediction     

No EC number prediction in MGYG000002454_01329.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT101	46	271	4.3e-75	0.9955357142857143

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR03728	glyco_access_1	1.31e-98	29	294	1	265	glycosyltransferase, SP_1767 family. Members of this protein family are putative glycosyltransferases. Some members are found close to genes for the accessory secretory (SecA2) system, and are suggested by Partial Phylogenetic Profiling to correlate with SecA2 systems. Glycosylation, therefore, may occur in the cytosol prior to secretion.
pfam08759	GT-D	4.13e-95	47	271	1	222	Glycosyltransferase GT-D fold. This domain is found at the C-terminus of proteins such as the probable glycosyltransferase Gly that also contain the glycosyl transferase domain at the N-terminus. It is also found N-terminal in numerous putative glycosyltransferases such as GalT1. GalT1 has been shown to catalyze the third step of Fap1 glycosylation. This domain is structurally distinct from all known GT folds of glycosyltransferases and contains a metal binding site. This new glycosyltransferase fold has been named GT-D.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QAA62989.1	1.48e-218	1	296	1	296
QAA67486.1	1.48e-218	1	296	1	296
QHV28889.1	1.48e-218	1	296	1	296
QHV26616.1	1.48e-218	1	296	1	296
QHV49737.1	1.48e-218	1	296	1	296

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4PFX_A	7.57e-59	28	294	13	277	Thehighly conserved domain of unknown function 1792 has a distinct glycosyltransferase fold [Streptococcus parasanguinis FW213]
4PHR_A	7.57e-59	28	294	13	277	Domainof unknown function 1792 (DUF1792) with manganese [Streptococcus parasanguinis FW213]
4PHS_A	9.50e-57	28	294	13	277	Selenomethioninesubstituted structure of domain of unknown function 1792 (DUF1792) [Streptococcus parasanguinis FW213]
5V4A_A	4.88e-56	29	293	8	271	ANew Glycosyltransferase (DUF1792) from Streptococcus sanguinis [Streptococcus sanguinis SK36],5V4A_B A New Glycosyltransferase (DUF1792) from Streptococcus sanguinis [Streptococcus sanguinis SK36]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9AEU2	7.27e-52	29	293	417	679	Probable glycosyl transferase Gly OS=Streptococcus gordonii OX=1302 GN=gly PE=3 SV=2
A0A0H2URB1	1.27e-44	28	293	549	812	Glycosyltransferase GlyD OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyD PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999597	0.000423	0.000018	0.000002	0.000001	0.000003

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002454_01329.