CAZyme Information: MGYG000002454_01450

Basic Information

• Species: Akkermansia muciniphila
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Verrucomicrobiales; Akkermansiaceae; Akkermansia; Akkermansia muciniphila
• CAZyme ID: MGYG000002454_01450
• CAZy Family: GH109
• CAZyme Description: Glycosyl hydrolase family 109 protein 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
481	MGYG000002454_1|CGC24	53803	8.5975

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002454	2762447	Isolate	China	Asia

• Gene Location: Start: 1743083; End: 1744528 Strand: +

Full Sequence      

MDNSSSRRRFLQTLGLATGALAAGSFANAQEVAPLAPKKITIPDPNNIGPMTTWPPRKPG
AIYMGGFRAPKLDKVRVAFVGVGERGSMHVGQMAVIEGAEIVGICDLYEDWAKRSADVVE
KKTGKRPPIFTKGPEDYKRMMKEVKPDAVIVCPSWEWHCRVTCDVMKMGAHAFVEVPMAV
SIKELWEIVDTSEETRKHCMMMENVNYGREELMYLNMVRQGVIGDLLYGEAAYIHELRGQ
MKQVERGTGSWRTYHYAKRNGNVYPTHGLGPIAQYMNLARKDDCFGRLVSFSSPALGRAA
YAKKNFPADHKWNKLDFACGDMNTSIIKTTMGRTVLVEWDETSPRPYSRLNLIQGTLGTL
AGFPTRVAGEKLGNGNYHEWIEGKEKLAPIFEKYDHPLWKRIGPLALKMGGHGGMDFVML
FRIIECLRNGEPMDQNVYEGAFWSSVSELSEYSVAQGGMPQVFPDFTRGDWKTTAPLGIV
Q

Enzyme Prediction     

EC	3.2.1.49

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	71	473	7.8e-158	0.9924812030075187

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	9.91e-14	74	299	3	214	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	1.05e-10	75	204	1	119	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
COG4091	COG4091	4.30e-04	75	119	18	62	Predicted homoserine dehydrogenase, contains C-terminal SAF domain [Amino acid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBH17724.1	0.0	1	481	1	481
QHV20177.1	0.0	1	481	1	481
QAA37789.1	0.0	1	481	1	481
QTF02981.1	0.0	1	481	1	481
QHV24667.1	0.0	1	481	1	481

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2B_A	4.67e-227	56	480	24	447	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
2IXA_A	1.97e-79	74	472	20	432	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B2UL75	0.0	1	481	1	481	Glycosyl hydrolase family 109 protein 1 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_0017 PE=3 SV=1
B2UQL7	9.68e-233	1	480	1	472	Glycosyl hydrolase family 109 protein 2 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_0920 PE=1 SV=1
A6WQ58	2.96e-175	7	480	6	457	Glycosyl hydrolase family 109 protein OS=Shewanella baltica (strain OS185) OX=402882 GN=Shew185_2813 PE=3 SV=1
A3D6B7	5.96e-175	7	480	6	457	Glycosyl hydrolase family 109 protein OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) OX=325240 GN=Sbal_2793 PE=3 SV=1
A9KUT1	3.41e-174	7	480	6	457	Glycosyl hydrolase family 109 protein OS=Shewanella baltica (strain OS195) OX=399599 GN=Sbal195_2933 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as TAT

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	0.000000	0.999961	0.000024	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002454_01450.