CAZyme Information: MGYG000002454_01499

Basic Information

• Species: Akkermansia muciniphila
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Verrucomicrobiales; Akkermansiaceae; Akkermansia; Akkermansia muciniphila
• CAZyme ID: MGYG000002454_01499
• CAZy Family: GH84
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
953		104594.35	9.4537

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002454	2762447	Isolate	China	Asia

• Gene Location: Start: 1800239; End: 1803100 Strand: -

Full Sequence      

MNGFQLLQCGLSVAAFLAGSALAATPAVYPSPQQSKFTTQTVAFSGKPSVTIRSAKAGGS
KLLEGVPEKSGAYKLVISPQGKVGIGAHDERGAFYAMQTLRQLGTKAGGEGVILPVGEII
DWPDIEFRGTVEGFYGTPWSHEARLSQLRFYGQNKMNTYIYGPKDDPYHSSPHWRDPYPA
DQAAQIRELVKVAKENHVDFVWAIHPGKDIKWTEEDMNNVIKKFEMMYKLGVRSFAVFFD
DIFGEGKRGDMQALLLNKINDEFVKVKKDVTPLVMCPTEYNRGWADPKPGTYLDILGDRL
DPSIHVMWTGNSVCHDITLEGQQWVNRRIKRPSYVWWNFPVTDYCRSNLCMGRVYGLASE
PGAKESMGGFVSNPMDKPEASKVSLFGLADYSWNINGFKSEESWKEGVRRLFPKAAEAMQ
VFVNHNSDQGPNGHGYRREESVEIEPVVKRVLEAAREGRIEKADAALLKKEFARMASAAP
VIRAKADNPRLMKEIGAWVDAFEQLGRAGQHAVAALEENNAGEAATHLVQATQALAAMDG
ISRRHNQEGQLYRSAVKTGSRVMAPAVNELADIVSKKVFPAIAGAPALSPKPLVKGGSMD
KAELFCDGDRGSFWHSGAYGQPGDWYGVDYGTPIPVRSVEVLMGRNDKDGDYVEKGQLEG
SRDLKTWKPLGPETAGMQVAWKAPKPVLLRAVRYRVIEPKKTGNGRAVWTAVREIAVNAP
PSAMASSNVAGLEGVSVQKSDKIVRINRVMETHKMKPGEFISLRLDGPTDATWLEVNLER
DDVNSWAEVVLDVEGSSKPVVQKLDKQGKNFIARGNQLPKGIRGMKLVNKSGKEQDIVLN
MFKFDVPPSDPGTSLVSLSDRNLKTVYRADKPLDVVVPNLDNPRASKVVVVGSAAFAIQA
RRGEGAWTLVGKRNAGPGVSEFAIPAGTSAVRLTYKAPQPDAIINEVIFSSRK

Enzyme Prediction     

No EC number prediction in MGYG000002454_01499.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH84	128	423	9.9e-112	0.9932203389830508

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07555	NAGidase	5.00e-167	128	422	1	293	beta-N-acetylglucosaminidase. This family has previously been described as a hyaluronidase. However, more recently it has been shown that this family has beta-N-acetylglucosaminidase activity.
pfam00754	F5_F8_type_C	7.65e-10	607	715	19	127	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
pfam02838	Glyco_hydro_20b	8.71e-09	25	121	1	123	Glycosyl hydrolase family 20, domain 2. This domain has a zincin-like fold.
COG3525	Chb	3.45e-07	64	129	199	265	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].
cd00057	FA58C	2.62e-05	607	670	30	92	Substituted updates: Jan 31, 2002

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHV26950.1	0.0	1	953	1	953
QHV22471.1	0.0	1	953	1	953
QAA37833.1	0.0	1	953	1	953
QAA67818.1	0.0	1	953	1	953
QTF05334.1	0.0	1	953	1	953

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2J4G_A	3.14e-167	66	568	73	565	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with n-butyl- thiazoline inhibitor [Bacteroides thetaiotaomicron VPI-5482],2J4G_B Bacteroides thetaiotaomicron GH84 O-GlcNAcase in complex with n-butyl- thiazoline inhibitor [Bacteroides thetaiotaomicron VPI-5482]
2J47_A	3.24e-167	66	568	74	566	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with a imidazole-pugnac hybrid inhibitor [Bacteroides thetaiotaomicron VPI-5482],2W4X_A BtGH84 in complex with STZ [Bacteroides thetaiotaomicron VPI-5482],2W66_A BtGH84 in complex with HQ602 [Bacteroides thetaiotaomicron VPI-5482],2W66_B BtGH84 in complex with HQ602 [Bacteroides thetaiotaomicron VPI-5482],2W67_A BtGH84 in complex with FMA34 [Bacteroides thetaiotaomicron VPI-5482],2W67_B BtGH84 in complex with FMA34 [Bacteroides thetaiotaomicron VPI-5482],2WCA_A BtGH84 in complex with n-butyl pugnac [Bacteroides thetaiotaomicron VPI-5482],2XJ7_A BtGH84 in complex with 6-acetamido-6-deoxy-castanospermine [Bacteroides thetaiotaomicron VPI-5482],2XJ7_B BtGH84 in complex with 6-acetamido-6-deoxy-castanospermine [Bacteroides thetaiotaomicron VPI-5482],2XM1_A BtGH84 in complex with N-acetyl gluconolactam [Bacteroides thetaiotaomicron VPI-5482],2XM1_B BtGH84 in complex with N-acetyl gluconolactam [Bacteroides thetaiotaomicron VPI-5482],2XM2_A BtGH84 in complex with LOGNAc [Bacteroides thetaiotaomicron VPI-5482],2XM2_B BtGH84 in complex with LOGNAc [Bacteroides thetaiotaomicron VPI-5482],4UR9_A Structure of ligand bound glycosylhydrolase [Bacteroides thetaiotaomicron],4UR9_B Structure of ligand bound glycosylhydrolase [Bacteroides thetaiotaomicron],5FKY_A Structure of a hydrolase bound with an inhibitor [Bacteroides thetaiotaomicron],5FKY_B Structure of a hydrolase bound with an inhibitor [Bacteroides thetaiotaomicron],5FL0_A Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL0_B Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL1_A Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL1_B Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron]
2JIW_A	3.24e-167	66	568	74	566	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with 2- Acetylamino-2-deoxy-1-epivalienamine [Bacteroides thetaiotaomicron VPI-5482],2JIW_B Bacteroides thetaiotaomicron GH84 O-GlcNAcase in complex with 2- Acetylamino-2-deoxy-1-epivalienamine [Bacteroides thetaiotaomicron VPI-5482]
2CHO_A	3.24e-167	66	568	74	566	Bacteroidesthetaiotaomicron hexosaminidase with O-GlcNAcase activity [Bacteroides thetaiotaomicron VPI-5482],2CHO_B Bacteroides thetaiotaomicron hexosaminidase with O-GlcNAcase activity [Bacteroides thetaiotaomicron VPI-5482]
7K41_A	3.55e-167	66	568	77	569	ChainA, O-GlcNAcase BT_4395 [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q89ZI2	3.38e-166	66	568	95	587	O-GlcNAcase BT_4395 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4395 PE=1 SV=1
Q8XL08	2.49e-94	69	616	129	659	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1
Q0TR53	9.01e-94	69	616	129	659	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
P26831	2.13e-52	75	829	135	928	Hyaluronoglucosaminidase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagH PE=1 SV=2
O60502	3.05e-35	129	401	63	342	Protein O-GlcNAcase OS=Homo sapiens OX=9606 GN=OGA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000341	0.999017	0.000193	0.000166	0.000159	0.000141

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002454_01499.