CAZyme Information: MGYG000002455_00335

Basic Information

• Species: Bacteroides cellulosilyticus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides cellulosilyticus
• CAZyme ID: MGYG000002455_00335
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
463	MGYG000002455_1|CGC8	51983.41	8.382

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002455	6974062	Isolate	United States	North America

• Gene Location: Start: 451757; End: 453148 Strand: -

Full Sequence      

MRGTANLFLIALLCLCCLSGCGNKRHGSMPDEAVGDLQQIKDSGELVVLTLYSSTSYFNY
RGQEMGFQYELSEQFAKSLGVKLRVVVARNVQGLIKKLLAGEGDIIAYNVPITKELKDSL
IYCGEEVITHQVIVQRAGGKTKPLTDVTELIGKDVYVKPGKYYDRLVNLDKELGGGIHIH
KVTNDSISVEDLITQVSQGKIPYTVADNDVARLNTTYYPNLNIKLSISFDQRASWAVRKD
SPELAAAANKWHEENMTSPAYTASMKRYFEISKATPHTSILSLREGKISHFDELFKKYAS
EIDWDWRLLASLAYTESNFDTTAVSWAGAKGLMQLMPATARAMGLPEGKEQNPEESVKAA
IKYINATSKSFSSVPKEERLNFVLASYNSGIGHVQDAMALAEKYGKNKYVWKDNVENFIL
LKSNEEYFTDPVCKNGYFRGIETYNFVRDIMGRYETYKKKIKK

Enzyme Prediction     

No EC number prediction in MGYG000002455_00335.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	303	458	7.7e-23	0.8296296296296296

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10859	PRK10859	9.08e-92	37	454	36	446	membrane-bound lytic murein transglycosylase MltF.
cd13403	MLTF-like	1.06e-80	295	459	1	161	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG4623	MltF	9.68e-80	35	450	14	424	Membrane-bound lytic murein transglycosylase MltF [Cell wall/membrane/envelope biogenesis, Signal transduction mechanisms].
cd01009	PBP2_YfhD_N	8.15e-75	44	270	1	223	The solute binding domain of YfhD proteins, a member of the type 2 periplasmic binding fold protein superfamily. This subfamily includes the solute binding domain YfhD_N. These domains are found in the YfhD proteins that are predicted to function as lytic transglycosylases that cleave the glycosidic bond between N-acetylmuramic acid and N-acetylglucosamin in peptidoglycan, while the YfhD_N domain might act as an auxiliary or regulatory subunit. In addition to periplasmic solute binding domain, they have an SLT domain, typically found in soluble lytic transglycosylases, and a C-terminal low complexity domain. The YfhD proteins might have been recruited to create localized cell wall openings required for transport of large substrates such as DNA. They belong to the PBP2 superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. They have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.
smart00062	PBPb	2.35e-23	45	269	1	219	Bacterial periplasmic substrate-binding proteins. bacterial proteins, eukaryotic ones are in PBPe

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ58392.1	0.0	1	463	1	463
QUT90489.1	0.0	1	463	1	463
QDO71062.1	0.0	9	462	6	459
QUU00068.1	1.67e-288	9	463	21	473
QUT34267.1	6.81e-288	9	463	21	473

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OWD_A	8.29e-46	27	455	1	426	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with cysteine [Pseudomonas aeruginosa PAO1],4OXV_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with valine [Pseudomonas aeruginosa PADK2_CF510],4P0G_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with bulgecin and muropeptide [Pseudomonas aeruginosa PAO1],4P11_A Native crystal structure of MltF Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
4OYV_A	1.15e-45	27	455	1	426	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with leucine [Pseudomonas aeruginosa PAO1]
4OZ9_A	7.20e-45	37	455	4	419	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with isoleucine [Pseudomonas aeruginosa PAO1]
5AA2_A	7.01e-44	27	455	35	460	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with NAM-pentapeptide. [Pseudomonas aeruginosa BWHPSA013],5AA2_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with NAM-pentapeptide. [Pseudomonas aeruginosa BWHPSA013]
5AA3_A	7.01e-44	27	455	35	460	Crystalstructure of MltF from Pseudomonas aeruginosa in the presence of tetrasaccharide and tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA3_B Crystal structure of MltF from Pseudomonas aeruginosa in the presence of tetrasaccharide and tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA3_C Crystal structure of MltF from Pseudomonas aeruginosa in the presence of tetrasaccharide and tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA3_D Crystal structure of MltF from Pseudomonas aeruginosa in the presence of tetrasaccharide and tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA3_E Crystal structure of MltF from Pseudomonas aeruginosa in the presence of tetrasaccharide and tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA3_F Crystal structure of MltF from Pseudomonas aeruginosa in the presence of tetrasaccharide and tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA3_G Crystal structure of MltF from Pseudomonas aeruginosa in the presence of tetrasaccharide and tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA3_H Crystal structure of MltF from Pseudomonas aeruginosa in the presence of tetrasaccharide and tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA3_I Crystal structure of MltF from Pseudomonas aeruginosa in the presence of tetrasaccharide and tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA3_J Crystal structure of MltF from Pseudomonas aeruginosa in the presence of tetrasaccharide and tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA3_K Crystal structure of MltF from Pseudomonas aeruginosa in the presence of tetrasaccharide and tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA3_L Crystal structure of MltF from Pseudomonas aeruginosa in the presence of tetrasaccharide and tetrapeptide [Pseudomonas aeruginosa BWHPSA013]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A8ZWR8	2.83e-55	32	460	29	451	Membrane-bound lytic murein transglycosylase F OS=Desulfococcus oleovorans (strain DSM 6200 / JCM 39069 / Hxd3) OX=96561 GN=mltF PE=3 SV=2
A4SNZ5	5.26e-53	1	456	12	452	Membrane-bound lytic murein transglycosylase F OS=Aeromonas salmonicida (strain A449) OX=382245 GN=mltF PE=3 SV=1
A0KJ50	1.98e-52	37	456	40	452	Membrane-bound lytic murein transglycosylase F OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=mltF PE=3 SV=1
Q6LU25	7.65e-50	6	456	13	452	Membrane-bound lytic murein transglycosylase F OS=Photobacterium profundum (strain SS9) OX=298386 GN=mltF PE=3 SV=1
B0TLJ6	1.36e-49	40	456	30	439	Membrane-bound lytic murein transglycosylase F OS=Shewanella halifaxensis (strain HAW-EB4) OX=458817 GN=mltF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000051	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002455_00335.