CAZyme Information: MGYG000002455_00599

Basic Information

• Species: Bacteroides cellulosilyticus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides cellulosilyticus
• CAZyme ID: MGYG000002455_00599
• CAZy Family: GH109
• CAZyme Description: Glycosyl hydrolase family 109 protein 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
517		58317.63	6.6929

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002455	6974062	Isolate	United States	North America

• Gene Location: Start: 273628; End: 275181 Strand: -

Full Sequence      

MKTFKTLLLGLCIVMCACSTQTPRQTNEYGTNWQWENGTIVIETPERPAGQKSVLGLTVP
KMEVVRVGFVGLGMRGPGAVERFTHIPGTQVVALCDYEQSRAERCQKYLKKASMPKAAIY
SGEKGYEELCKRDDIDLVYIAADWLHHFPVAKYALENGKHVAIEVPSAMNLQQCWDLINM
SEKYRKHCMILENCCYDWFEMNTLNMAQQGVFGEVIRAQGAYIHNLSPFWNHYWKNGEND
KLGWRLDYNMRHRGDVYATHGLGPVAQALDIHRGDRMKTLVAMDTKSAIGKALVEERADS
ICNNFRNGDHTTTLIRTENGKVIEIQHNVMTPQPYNRLYQLTGTKGFANKYPISGYALDA
KQLTASGVQPKIDDLNSHSFLPKSEMETLVAKYQHPILKKYGEMAKEVGGHGGMDFIMDC
RLVYCLQNGLPLDMDVYDLAEWCCLAELGTLSMDNNCAAVAFPDFTRGEWNVVKGYKHAY
ASPEEEKAVAEKAAAFTAKLKEQGEKEWGETENQEAK

Enzyme Prediction     

No EC number prediction in MGYG000002455_00599.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	61	471	1.3e-158	0.9899749373433584

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	1.93e-21	62	348	1	257	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	7.38e-13	65	190	1	118	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
PRK11579	PRK11579	5.61e-07	63	215	3	145	putative oxidoreductase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ59362.1	0.0	1	517	1	517
QUT89581.1	0.0	1	517	1	517
QUT44459.1	0.0	1	508	1	509
QRQ49631.1	0.0	1	508	1	509
QUU00485.1	0.0	1	510	1	511

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2B_A	5.84e-82	47	470	25	438	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
2IXA_A	3.06e-68	65	474	21	435	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
3E82_A	9.81e-09	64	215	12	148	Crystalstructure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_B Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_D Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_E Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665]
3E9M_A	1.47e-07	101	221	39	154	CrystalStructure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis],3E9M_B Crystal Structure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis],3E9M_C Crystal Structure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis],3E9M_D Crystal Structure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis]
3EVN_A	2.53e-06	65	216	6	149	CRYSTALSTRUCTURE OF putative oxidoreductase from Streptococcus agalactiae 2603V/r [Streptococcus agalactiae serogroup V]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A6L1Z2	0.0	1	508	1	511	Glycosyl hydrolase family 109 protein 5 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_2041 PE=3 SV=1
A6KWM1	0.0	1	508	1	510	Glycosyl hydrolase family 109 protein 4 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0105 PE=3 SV=1
A6KYY1	1.14e-242	5	502	4	499	Glycosyl hydrolase family 109 protein 3 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0950 PE=3 SV=1
Q89ZX8	6.20e-208	8	481	9	466	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4243 PE=3 SV=1
P0C863	3.20e-207	2	481	3	463	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=BF0931 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000028	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002455_00599.