CAZyme Information: MGYG000002455_00756

Basic Information

• Species: Bacteroides cellulosilyticus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides cellulosilyticus
• CAZyme ID: MGYG000002455_00756
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
390		44359.01	5.0114

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002455	6974062	Isolate	United States	North America

• Gene Location: Start: 3922; End: 5094 Strand: -

Full Sequence      

MKKVYMAIFIALLGCSSCSKDNDDSAPEPPGTETVELSMVDKSATAETKALYARLWDIQQ
TGFMFGHHDDLFYGRKWYDVSGNSDTKEVCGDYPAVFSVDFAEIMDDRCEENEANAVRKR
CILEARRRGEVIIACCHLNNPLTGGDSWDNSSAEVVRGILEDGSAVQAKFKTWLDRLATF
AGELKDDQGKPIPVIFRPFHEHTQTWSWWGKSCTTEAEFIGLWKFTVNYLRDTKGIHQFV
YAISPQMDSVKREEDFLFRWPGDEYVDFIGMDCYHGLNPATFSSNLKTISELSKKKKKPC
GVTETGVEGFTDKDYWSKQILTPATGRKVSMIVMWRNKFVGGNESDMHYFSVFKGHASEA
DFIKFHANELTFFSSDLPDMYQMPENVEVN

Enzyme Prediction     

No EC number prediction in MGYG000002455_00756.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	40	344	6.8e-59	0.9273927392739274

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	2.94e-31	40	274	1	230	Glycosyl hydrolase family 26.
COG4124	ManB2	2.43e-16	169	355	159	340	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT88729.1	5.03e-303	1	390	1	390
ALJ60278.1	9.73e-301	1	389	1	389
QGT72560.1	3.63e-184	1	389	1	393
QRM99613.1	3.63e-184	1	389	1	393
CBK67266.1	3.63e-184	1	389	1	393

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZXO_A	1.89e-71	45	383	9	345	Thestructure of a GH26 beta-mannanase from Bacteroides ovatus, BoMan26A. [Bacteroides ovatus]
4CD4_A	2.90e-68	12	382	21	419	Thestructure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManIFG [Cellvibrio japonicus Ueda107],4CD5_A The structure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManMIm [Cellvibrio japonicus Ueda107]
2VX4_A	6.18e-68	25	382	19	396	CellvibrioJaponicus Mannanase Cjman26c Native Form [Cellvibrio japonicus],2VX6_A CELLVIBRIO JAPONICUS MANNANASE CJMAN26C Gal1Man4-BOUND FORM [Cellvibrio japonicus]
2VX5_A	8.70e-68	25	381	19	395	CellvibrioJaponicus Mannanase Cjman26c Mannose-Bound Form [Cellvibrio japonicus]
2VX7_A	4.81e-67	25	382	19	396	CellvibrioJaponicus Mannanase Cjman26c Mannobiose-Bound Form [Cellvibrio japonicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49424	4.94e-53	10	384	23	418	Mannan endo-1,4-beta-mannosidase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=manA PE=1 SV=2
A1A278	2.59e-35	37	384	40	406	Mannan endo-1,4-beta-mannosidase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) OX=367928 GN=BAD_1030 PE=1 SV=1
O05512	1.24e-12	73	274	66	268	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=gmuG PE=1 SV=2
P49425	2.19e-12	29	316	138	422	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
G2Q4H7	1.91e-11	25	297	162	416	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000037	1.000020	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002455_00756.