CAZyme Information: MGYG000002455_00825

Basic Information

• Species: Bacteroides cellulosilyticus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides cellulosilyticus
• CAZyme ID: MGYG000002455_00825
• CAZy Family: GH30
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
522	MGYG000002455_3|CGC3	59303.87	6.2961

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002455	6974062	Isolate	United States	North America

• Gene Location: Start: 110495; End: 112063 Strand: -

Full Sequence      

MRYKVLLLVFTIVCVSCAQRADINYKIVTGQPLQVMEHFGASDAWSMHVLGKWPEEKQKQ
IADWLFSTENDANGKPKGIGLSLWRFNLGAGSTEQGDASQIGSPWMRTECFLQPDGSYNW
DKQEGQRNFLRLAKERGVNKFLAFLNSPPVYFTQNGLATNTGRDGTLNLKDEHYEDFARF
LANVIKGVEKKDGIKFDYLSPFNEPDGHWNWIGPKQEGTPATKKEIARAVRLISKEFVKE
GIHTGITICEASDYRCMFATHMTDHERGYEIQSFFCPDSVDTYLGDTPNVLPLISGHSYW
TTTPLNMLRDYRLRLRNTLDTYGVDFWQSETCIMGNDEEIGGGHGFDRTMKTALYVARII
HHDIVYAGARSWQWWRAIGGDYKDGLIREYTDPDLQDGRVEDSKLMWILGNYSRFIRPGA
VRMSVETTDKEGKAIRDGDTDQQGLMCSAYRNTDGQWAMVVINYADREQEFTVDVNDPKV
KSWQGYRTSDVAGEDLLPVGKLKNKKVTVIPARSVTTFVSGN

Enzyme Prediction     

EC	3.2.1.38

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	24	519	1e-195	0.9958677685950413

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14587	Glyco_hydr_30_2	2.06e-147	34	387	13	366	O-Glycosyl hydrolase family 30.
COG5520	XynC	4.55e-14	1	519	1	427	O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis].
pfam17189	Glyco_hydro_30C	1.35e-05	419	518	1	63	Glycosyl hydrolase family 30 beta sandwich domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ60213.1	0.0	1	522	1	522
QUT88786.1	0.0	1	522	1	522
ALJ59968.1	0.0	1	520	1	520
QUT89019.1	0.0	1	520	1	520
QDO68226.1	0.0	1	522	1	522

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CLW_A	5.61e-96	34	519	17	495	Crystalstructure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_B Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_C Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_D Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_E Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_F Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
6IUJ_A	1.86e-16	34	520	33	471	ChainA, GH30 Xylanase B [Talaromyces cellulolyticus CF-2612],6IUJ_B Chain B, GH30 Xylanase B [Talaromyces cellulolyticus CF-2612]
7O0E_A	2.24e-16	34	519	14	446	ChainA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464],7O0E_G Chain G, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
6KRL_A	2.34e-16	34	520	104	542	Crystalstructure of GH30 xylanase B from Talaromyces cellulolyticus expressed by Pichia pastoris [Saccharomyces uvarum],6KRN_A Crystal structure of GH30 xylanase B from Talaromyces cellulolyticus expressed by Pichia pastoris in complex with aldotriuronic acid [Saccharomyces uvarum]
7NCX_AAA	4.52e-16	34	519	21	453	ChainAAA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q76FP5	1.88e-17	20	483	19	436	Endo-beta-1,6-galactanase OS=Hypocrea rufa OX=5547 GN=6GAL PE=1 SV=1
G2Q1N4	2.46e-16	34	519	38	470	GH30 family xylanase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Xyn30A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000191	0.067020	0.932737	0.000027	0.000039	0.000030

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002455_00825.