CAZyme Information: MGYG000002455_00826

Basic Information

• Species: Bacteroides cellulosilyticus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides cellulosilyticus
• CAZyme ID: MGYG000002455_00826
• CAZy Family: CBM32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
447	MGYG000002455_3|CGC3	49938.04	4.2688

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002455	6974062	Isolate	United States	North America

• Gene Location: Start: 112175; End: 113518 Strand: -

Full Sequence      

MKIRTILLMGGLVLLGACSESKYDLDQLVPEEYHKILYVNNSGKQDLTLYDTDEDNKYTL
SVVKSGSDPSLTASVKVSVLTQAELDEEYSEPEGTNYKLIGENCYSLDATTLDFSSADRY
KLVNIFLKPQSVKAFMETDPEAVWVLPLQVTSETDSINAEKNELFLKLTGVITPAIGFAN
SDVEVKLLDYGSVSTFTEKVKFGLDTDNKWDLECKFVVDKEYIAEYNADNGTNFKVLPEG
TYTVPEMVTLPNGTTNMELEVTINGDQLVPGDYMLPVKIAEVSQFEISAAKVVSPLAFRV
MGHKLDRAGWTAEANTEELTGEGASGKAGCALDDNLATYWHSTWQTGNWVSFPFEIIVDT
KTEHTFTQFALMQRQNESYTDTKSGKFYVSSDKENWTEVGRFSMEKILDRQVFGVTPTKG
RYFKVSIEESYRGTNASLSEIYAYALE

Enzyme Prediction     

No EC number prediction in MGYG000002455_00826.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM32	314	442	4.9e-16	0.9596774193548387

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08522	DUF1735	6.77e-17	176	286	7	120	Domain of unknown function (DUF1735). This domain of unknown function is found in a number of bacterial proteins including acylhydrolases. The structure of this domain has a beta-sandwich fold.
pfam08522	DUF1735	3.88e-12	36	157	7	120	Domain of unknown function (DUF1735). This domain of unknown function is found in a number of bacterial proteins including acylhydrolases. The structure of this domain has a beta-sandwich fold.
pfam00754	F5_F8_type_C	4.15e-11	322	440	8	125	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT88787.1	0.0	1	447	1	447
BCA52367.1	7.23e-190	1	446	1	446
QUT73146.1	7.23e-190	1	446	1	446
QUT40999.1	5.89e-189	1	446	1	446
QGT72760.1	7.28e-181	7	447	10	449

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3F2Z_A	2.57e-14	302	441	2	143	Crystalstructure of the C-terminal domain of a chitobiase (BF3579) from Bacteroides fragilis, Northeast Structural Genomics Consortium Target BfR260B [Bacteroides fragilis NCTC 9343]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000037	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002455_00826.